DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and pdx1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_002934065.1 Gene:pdx1 / 100490648 XenbaseID:XB-GENE-483331 Length:271 Species:Xenopus tropicalis


Alignment Length:169 Identity:65/169 - (38%)
Similarity:83/169 - (49%) Gaps:36/169 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 DSDEDLMAETTDGERIIYPWMK--KIHV--AGVANGSY-QPGMEPKRQRTAYTRHQILELEKEFH 386
            |..|....|..:...:.:||||  |.|.  .....||| ....|.||.||||||.|:|||||||.
 Frog   103 DDTESATLEERNRTLLPFPWMKSTKSHTWKGQWTGGSYIMEQEENKRTRTAYTRAQLLELEKEFL 167

  Fly   387 YNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK--DNK----------------------- 426
            :|:|::|.||:|:|..|.|:||.||||||||||||||  |.|                       
 Frog   168 FNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGRGSDPEQDSVVSSADVIKDEP 232

  Fly   427 --LPNTKN----VRKKTVDANGNPTPVAKKPTKRAASKK 459
              |.|::|    ||...:..:....|:....:.|.|.|:
 Frog   233 QCLGNSQNTGDLVRSSALPTSPQSNPIPATGSLRQAEKR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 36/51 (71%)
pdx1XP_002934065.1 Homeobox 150..204 CDD:365835 37/53 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.