DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and sia3

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_002942209.2 Gene:sia3 / 100490453 XenbaseID:XB-GENE-480406 Length:247 Species:Xenopus tropicalis


Alignment Length:117 Identity:33/117 - (28%)
Similarity:50/117 - (42%) Gaps:12/117 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 RQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKN 432
            |:||.||:.|...|:.:|..|.|.....|..||....:.|.:|::||||||.:     .|.....
 Frog   139 RKRTIYTKEQTDFLQNQFDINPYPDFVSRCHIAQLTGVPEPRIQVWFQNRRAR-----HLSKIHR 198

  Fly   433 VRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECI 484
            .::.|:......|     .|::..|...|..  ..:|.:.|.|..|.|..|:
 Frog   199 SQEPTIQEASTLT-----GTQKLISHVHQST--NPRSPRSQDQYLPDMVTCM 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 20/51 (39%)
sia3XP_002942209.2 COG5576 <123..236 CDD:227863 30/108 (28%)
homeodomain 139..192 CDD:238039 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.