DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and tmprss9

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_002940084.3 Gene:tmprss9 / 100489279 XenbaseID:XB-GENE-993973 Length:1151 Species:Xenopus tropicalis


Alignment Length:138 Identity:29/138 - (21%)
Similarity:51/138 - (36%) Gaps:34/138 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   419 MKWKKDNKLP--NTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMN 481
            |...:.:.||  .|:....:...:||..|....:||               .||.:.|:.||   
 Frog   789 MNLPRSSPLPISTTRPSTFQPATSNGRRTTTLTRPT---------------MSQTKSTRSTP--- 835

  Fly   482 ECIRSDSLESIGDVSSSLGNPPYI----PA------APETTSSYPGSQQ-HLSNNNNNGSGNNNN 535
               ||.:..:....:::..:|..:    ||      .|.:.|:|..|.: .:|..|....|..:.
 Frog   836 ---RSTTKYTSKRTTTAKTSPTALRITEPARSTQRPVPCSASTYKCSNRVCISKPNPECDGIQDC 897

  Fly   536 NNNNNNSN 543
            ||.::..|
 Frog   898 NNGSDEQN 905

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 1/2 (50%)
tmprss9XP_002940084.3 SEA 60..156 CDD:396113
LDLa 186..221 CDD:238060
Tryp_SPc 234..463 CDD:214473
Tryp_SPc 547..774 CDD:238113
LDLa 871..906 CDD:238060 9/35 (26%)
Tryp_SPc 919..1145 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6065
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm47668
Panther 1 1.100 - - O PTHR45771
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.100

Return to query results.
Submit another query.