DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxc5

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_002936695.2 Gene:hoxc5 / 100487879 XenbaseID:XB-GENE-485672 Length:225 Species:Xenopus tropicalis


Alignment Length:308 Identity:92/308 - (29%)
Similarity:118/308 - (38%) Gaps:132/308 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 AHPHQSLGYYVHHAPEFISAGAVHSDPTNGY------------GP-------AANVPNTSNGGGG 191
            |:..||.|.|          |:|...|::.|            .|       |.::|:..|....
 Frog    18 AYSMQSYGNY----------GSVSEVPSSRYCYSGLDLSITFPSPGSSNSLSALDMPSNPNANSE 72

  Fly   192 -------GGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSST 249
                   |.||..:|.|......:|.|          |....:|..:..|.       .::...|
 Frog    73 RPSCTVMGSSGHTVGRGEQSALNSGIY----------NQKAATTSLEERSK-------GIESIKT 120

  Fly   250 EPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDEL 314
            ||..:|..|.|              |..||.|:                            |.: 
 Frog   121 EPAQSTPQGGQ--------------PQQQQQQQ----------------------------PPQ- 142

  Fly   315 GSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQIL 379
                                        |||||.|:|::...:|        ||.||:|||:|.|
 Frog   143 ----------------------------IYPWMTKLHMSHETDG--------KRSRTSYTRYQTL 171

  Fly   380 ELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKL 427
            |||||||:|||||||||||||:.|.|:||||||||||||||||||.|:
 Frog   172 ELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDTKV 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 43/51 (84%)
hoxc5XP_002936695.2 Homeobox 161..215 CDD:395001 44/53 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.