DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and arx

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_002933659.1 Gene:arx / 100486727 XenbaseID:XB-GENE-483940 Length:536 Species:Xenopus tropicalis


Alignment Length:290 Identity:71/290 - (24%)
Similarity:107/290 - (36%) Gaps:94/290 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 YGTANGSVGSTHSQGHS------PHSQMMDLPLQCSSTEPPT--NTALGLQ---ELGLKLEKRI- 270
            ||...|| |..|.|..:      |.|:..|..|........|  |.:|.:.   ::.:...|.. 
 Frog    85 YGPVGGS-GRIHLQAVADARSGVPRSEKTDRILLLGGAGENTWDNHSLKISQAPQVSISRSKSYR 148

  Fly   271 --------EEAVPAG-----QQLQELGMRLRC----DDMGS--------ENDDMSEEDRLMLDRS 310
                    ||..|.|     ||..:......|    |.:|:        ::||..:||....:..
 Frog   149 ENSAPLLREEHSPEGLLQQSQQQIQTSATTACTSLQDRLGALSQSPRDEDDDDEEDEDEEEEEEE 213

  Fly   311 PDELGSNDNDDDLGD-----------------------------SDSD----EDLM-----AETT 337
            .||.....|.::..:                             :|::    |:||     |:..
 Frog   214 EDEANKQHNPNNSSNPNRAHLQEQQHPQFQSQQSQQQQPPPGCGTDAELSPKEELMLHSSDADGK 278

  Fly   338 DGERIIYPWMKKIHVAGVANGSYQPGM---EPKRQRTAYTRHQILELEKEF---HYNRYLTRRRR 396
            |||.         .|...|....:.||   :.:|.||.:|.:|:.|||:.|   ||....||.  
 Frog   279 DGED---------SVCLSAGSDSEEGMLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTRE-- 332

  Fly   397 IEIAHTLVLSERQIKIWFQNRRMKWKKDNK 426
             |:|..|.|:|.::::||||||.||:|..|
 Frog   333 -ELAMRLDLTEARVQVWFQNRRAKWRKREK 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 24/54 (44%)
arxXP_002933659.1 Homeobox 305..358 CDD:365835 25/55 (45%)
OAR 500..518 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.