DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxa11

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_002933440.2 Gene:hoxa11 / 100485262 XenbaseID:XB-GENE-483242 Length:359 Species:Xenopus tropicalis


Alignment Length:287 Identity:79/287 - (27%)
Similarity:116/287 - (40%) Gaps:96/287 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 VHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYY---GGYGGGYGTANGSVGSTH 229
            |:|:|:    |..||                  |:|  ...||:   ..||...|..||.:.:..
 Frog   154 VNSEPS----PEQNV------------------GSV--PIPGYFRLSQAYGSSKGYGNGHIVAPQ 194

  Fly   230 SQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEA------VPAGQQLQELGMRLR 288
            ....|  ....|.|...||.  ||..|            |.|.|      :|.|.|.:       
 Frog   195 FPAQS--QVRFDAPASLSSV--PTENA------------RKESAESPVSKLPVGSQQR------- 236

  Fly   289 CDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVA 353
                                |..:.|.|:...::...:.||.   ::.:.|:.::          
 Frog   237 --------------------REEETLSSSSAAEESSPAPSDS---SKHSPGKELV---------- 268

  Fly   354 GVANG----SYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWF 414
            |.|.|    ::......:::|..||:||.|||||||.:|.||||.||:||:.::.||:||:||||
 Frog   269 GNAKGDNAATWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLSDRQVKIWF 333

  Fly   415 QNRRMKWKKDNKLPNTKNVRKKTVDAN 441
            ||||||.||.|:   ...:|:.|.:.|
 Frog   334 QNRRMKLKKMNR---ENRIRELTANFN 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 35/51 (69%)
hoxa11XP_002933440.2 Homeobox 288..342 CDD:365835 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.