DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxb2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_002727852.1 Gene:Hoxb2 / 100361765 RGDID:2319509 Length:355 Species:Rattus norvegicus


Alignment Length:215 Identity:72/215 - (33%)
Similarity:104/215 - (48%) Gaps:52/215 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 YPWMKK--------------------IHVAGVANGSYQPGME------PKRQRTAYTRHQILELE 382
            :||||:                    :..:||.:.|..||:.      .:|.|||||..|:||||
  Rat    94 FPWMKEKKSAKKPSQSAATPSPAASSVRASGVGSPSDGPGLPESGGSGSRRLRTAYTNTQLLELE 158

  Fly   383 KEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKD---NKLPNTKNVRKKTVDANGNP 444
            ||||:|:||.|.||:|||..|.|:|||:|:||||||||.|:.   .:.|:.:.......|..|.|
  Rat   159 KEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQHREPPDGEPGGLSAQDDAGEP 223

  Fly   445 TPVAKKPTKR---AASKKQQQA--QQQQQSQQQQTQQTPVMNECIRSDSLESIGDVS-------- 496
               |::||..   .||.:.::|  ...:.:|..:....|:.    .:.:|||:|..|        
  Rat   224 ---AEEPTVSPGDVASHRLREACFLPAEAAQGPRGAPPPLP----PATALESVGASSPGCTMLRA 281

  Fly   497 SSLGNPPYIP--AAPETTSS 514
            ..|.:.| :|  |.||...|
  Rat   282 GGLQSEP-LPEDACPERQDS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 37/51 (73%)
Hoxb2XP_002727852.1 Homeobox 146..198 CDD:278475 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.