DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and LOC100361016

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_008771600.2 Gene:LOC100361016 / 100361016 RGDID:2320944 Length:335 Species:Rattus norvegicus


Alignment Length:95 Identity:28/95 - (29%)
Similarity:52/95 - (54%) Gaps:8/95 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 GVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRR 418
            |...|...| .:.:::||.|:..|...|::.|...:|..:::.:|:|..:.::|::||:||:|.|
  Rat   107 GKQTGPVAP-RKRRKERTQYSAKQKSVLQEHFAECQYPDKKQCLELASLVRVTEKEIKVWFKNNR 170

  Fly   419 MKWKKDNKLPNTKNVRKKTVDANGNPTPVA 448
            .|.|:       |||.:...:.||.|..|:
  Rat   171 AKCKQ-------KNVPEALPEKNGGPEAVS 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 17/51 (33%)
LOC100361016XP_008771600.2 HOX 118..174 CDD:197696 17/55 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.