DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxd8

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001135589.1 Gene:hoxd8 / 100216142 XenbaseID:XB-GENE-920113 Length:231 Species:Xenopus tropicalis


Alignment Length:125 Identity:57/125 - (45%)
Similarity:74/125 - (59%) Gaps:26/125 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 IYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSE 407
            ::|||:    |.||.|.       :|.|..|:|.|.|||||||.:|.||||:||||::|.|.|:|
 Frog   127 MFPWMR----AQVAPGR-------RRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALGLTE 180

  Fly   408 RQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQ 467
            ||:|||||||||||||:|               :.:..||:.:..|..|.||....|:||
 Frog   181 RQVKIWFQNRRMKWKKEN---------------SKDKFPVSSQEGKEEADKKGGLHQEQQ 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 36/51 (71%)
hoxd8NP_001135589.1 Homeobox 143..196 CDD:365835 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.