DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and meox2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001116898.1 Gene:meox2 / 100144655 XenbaseID:XB-GENE-852818 Length:300 Species:Xenopus tropicalis


Alignment Length:430 Identity:99/430 - (23%)
Similarity:134/430 - (31%) Gaps:192/430 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VQSPMSMGNGLDPKFPPLADDYHHYNGHYSMTASTGHMSGAVGGGAGVGSVGGGGAGGMTGHPHS 79
            ::||.:...||.| |...:...|..:.|.|....:...|..:                :||:|:.
 Frog     9 LRSPHATSQGLHP-FAQSSLALHGRSDHMSYPDLSSSSSSCI----------------LTGYPNE 56

  Fly    80 MHPADMVSDYMAHHHNPHSHSHSHTHSLPHHHSNSAISGHHQASAGGYSSNYANATPPSHPHSHP 144
                  ...:.:.||..|.|.|.|     |||       |.|.......||:......|.|.|..
 Frog    57 ------EGMFGSQHHRGHHHHHHH-----HHH-------HQQQQHQTLQSNWHIPQMSSPPASTR 103

  Fly   145 HAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANG 209
            |     ||.......|..:|.           .|:....|||:.|....:||        ....|
 Frog   104 H-----SLCLQQESGPPDLSG-----------SPSILCSNTSSLGTNSSTGA--------ACVTG 144

  Fly   210 YYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAV 274
            .||                 .|..||                            .:.|||     
 Frog   145 DYG-----------------RQTLSP----------------------------AEAEKR----- 159

  Fly   275 PAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDG 339
                                                   .|...:|    .|||.|         
 Frog   160 ---------------------------------------TGKRKSD----SSDSQE--------- 172

  Fly   340 ERIIYPWMKKIHVAGVANGSYQPGM--EPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHT 402
                              |||:..:  :|:::|||:|:.||.|||.||.::.||||.||.|||..
 Frog   173 ------------------GSYKSDVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVN 219

  Fly   403 LVLSERQIKIWFQNRRMKWK-----------KDNKLPNTK 431
            |.|:|||:|:||||||||||           ::.:|.|.|
 Frog   220 LDLTERQVKVWFQNRRMKWKRVKGGQQGAAAREKELGNVK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 34/51 (67%)
meox2NP_001116898.1 COG5576 157..269 CDD:227863 52/178 (29%)
Homeobox 187..240 CDD:365835 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.