DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and nkx2-5

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001116891.1 Gene:nkx2-5 / 100144646 XenbaseID:XB-GENE-487966 Length:300 Species:Xenopus tropicalis


Alignment Length:362 Identity:86/362 - (23%)
Similarity:142/362 - (39%) Gaps:94/362 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 HSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMG 293
            |..|.||    ||:..:             |:.....|....:|..|....|.||          
 Frog    22 HQSGLSP----MDITSR-------------LENSSCMLSTFKQEPYPGTPCLSEL---------- 59

  Fly   294 SENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKI-HVAGVAN 357
              .:::::.|.   .:.|.....:....:..:.||.:|    ..|.::.|.|..|.: |....|.
 Frog    60 --TEELAQRDS---SKGPSPFPGSFFVKNYLEMDSSKD----PKDDKKDICPLQKTLEHDKREAE 115

  Fly   358 GSYQPGMEPKRQ-RTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKW 421
            ...:|....:|: |..:::.|:.|||:.|...:||:...|..:|:.|.|:..|:||||||||.|.
 Frog   116 DPERPRQRKRRKPRVLFSQAQVYELERRFKQQKYLSAPERDHLANVLKLTSTQVKIWFQNRRYKC 180

  Fly   422 KKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRS 486
            |:..        :.:|::..|.|      |.:|.|                    .||:   :| 
 Frog   181 KRQR--------QDQTLEMVGLP------PPRRIA--------------------VPVL---VR- 207

  Fly   487 DSLESIGDVSSSLGNPPY-IPAAPETTSSYPGSQQHLSNNNNNG-SGNNNNNNNNNNSNLNNNNN 549
            |....:|:  ||..|.|| :...|.:.::||.    .||.:|.. ||:.|.:.::..|....:..
 Frog   208 DGKPCLGE--SSPYNSPYNVSINPYSYNTYPA----YSNYSNPACSGSYNCSYSSMPSMQPTSAG 266

  Fly   550 NNQMGHTNLHGHLQQQQSDLMTNLQLHIKQDYDLTAL 586
            ||.|..:         ..||.| :|..|:|...::||
 Frog   267 NNFMNFS---------VGDLNT-VQTPIQQASGVSAL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 22/51 (43%)
nkx2-5NP_001116891.1 Homeobox 132..182 CDD:365835 21/49 (43%)
COG5576 <133..235 CDD:227863 39/141 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.