DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxb6

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_002938066.1 Gene:hoxb6 / 100124320 XenbaseID:XB-GENE-1006005 Length:223 Species:Xenopus tropicalis


Alignment Length:148 Identity:69/148 - (46%)
Similarity:89/148 - (60%) Gaps:21/148 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 LGSNDNDDDLGDSDSDED-----LMAETTDGERI---IYPWMKKIHVAGVANGSYQPGMEPKRQR 370
            |.|.:.....|......|     |:.|..|..:.   :||||::::   ..|.|.. |...:|.|
 Frog    89 LSSLEEQSQFGQEQRKADCAHSKLLYEEQDEAKCATPVYPWMQRMN---SCNSSVF-GPSGRRGR 149

  Fly   371 TAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRK 435
            ..|||:|.||||||||:||||||||||||||:|.|:|||||||||||||||||::||.|:     
 Frog   150 QTYTRYQTLELEKEFHFNRYLTRRRRIEIAHSLCLTERQIKIWFQNRRMKWKKESKLLNS----- 209

  Fly   436 KTVDANGNPTPVAKKPTK 453
             :|.:.|..   .:|||:
 Frog   210 -SVQSAGED---EEKPTE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 43/51 (84%)
hoxb6XP_002938066.1 Homeobox 149..202 CDD:365835 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.