DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and shox2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001093694.1 Gene:shox2 / 100101703 XenbaseID:XB-GENE-480993 Length:311 Species:Xenopus tropicalis


Alignment Length:261 Identity:55/261 - (21%)
Similarity:84/261 - (32%) Gaps:108/261 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 VHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQG 232
            :.|.|..|..|..        |.|.....:.|...:||...|  ||.|||              .
 Frog    29 LESGPARGKEPGC--------GEGAREDGLAGNRCIGGGGGG--GGGGGG--------------A 69

  Fly   233 HSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSEND 297
            .||                       :.||.|.:|:..|...|   :|.|:...::         
 Frog    70 RSP-----------------------VLELDLSVERIRESGSP---KLTEVSPEIK--------- 99

  Fly   298 DMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQP 362
                                         :..|:|..:..:.|.                   |.
 Frog   100 -----------------------------ERKEELKQQALEEEG-------------------QT 116

  Fly   363 GMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK-DNK 426
            .::.:|.||.:|..|:.|||:.|....|.....|.|::..|.|||.::::||||||.|.:| :|:
 Frog   117 KIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQ 181

  Fly   427 L 427
            |
 Frog   182 L 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 22/51 (43%)
shox2NP_001093694.1 Homeobox 123..177 CDD:365835 22/53 (42%)
OAR 292..307 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.