DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and ventx1.1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001107707.1 Gene:ventx1.1 / 100101668 XenbaseID:XB-GENE-920501 Length:277 Species:Xenopus tropicalis


Alignment Length:311 Identity:78/311 - (25%)
Similarity:98/311 - (31%) Gaps:133/311 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 PHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRC-DDMGSENDD 298
            ||......||      .||..|               :.:|..:..||.|..... ..:|...|.
 Frog    30 PHIPCAPQPL------APTKYA---------------KEIPRRKDGQEQGDATSFQSSLGKHGDK 73

  Fly   299 M--SEEDRLMLDR---SPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANG 358
            :  |......|.|   |.||..|..::||             :|||    :|       :.|.|.
 Frog    74 LHYSSPSSAALHRNWGSSDEFSSAGSEDD-------------STDG----FP-------SPVRNS 114

  Fly   359 SYQP----GMEPK-----RQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWF 414
            ....    |..||     |.|||:| .||..||:.|:..|||....|.::|.:|.|||.|:|.||
 Frog   115 QETETDCRGKSPKSDLQRRLRTAFT-PQISRLEQAFNKQRYLGASERKKLATSLRLSEIQVKTWF 178

  Fly   415 QNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPV 479
            ||||||.|:                                            |.|.||....| 
 Frog   179 QNRRMKLKR--------------------------------------------QIQDQQHSMVP- 198

  Fly   480 MNECIRSDSLESIGDVSSSLGNPPYIPAAPETTSSYPGSQQHLSNNNNNGS 530
                                  ||.  ..|:|.|.|||.   |....|:||
 Frog   199 ----------------------PPV--CYPQTFSYYPGG---LPVPLNSGS 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 28/51 (55%)
ventx1.1NP_001107707.1 Homeobox 135..186 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.