DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxa2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_004915456.1 Gene:hoxa2 / 100038099 XenbaseID:XB-GENE-488087 Length:373 Species:Xenopus tropicalis


Alignment Length:255 Identity:75/255 - (29%)
Similarity:103/255 - (40%) Gaps:81/255 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 YPWM------KKIHVA---GVANGSYQPGME------------------PKRQRTAYTRHQILEL 381
            ||||      ||..:|   ..|..|..|...                  .:|.|||||..|:|||
 Frog    91 YPWMKEKKASKKAPIAAATAAAAASAAPATTACLSHKEIIEIQDNSSGGSRRLRTAYTNTQLLEL 155

  Fly   382 EKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKN--VRKKTVDANGNP 444
            |||||:|:||.|.||:|||..|.|:|||:|:||||||||.|:..:....:|  .:.|.:|.:...
 Frog   156 EKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQNGDGKFKHLDDSEKG 220

  Fly   445 TPVAKKP-------------TKRAASKKQQQAQQQQQSQQQQT---------------------- 474
            ....:|.             .:|.:...||.|..||||.....                      
 Frog   221 EEEKEKSLFEQALNSVSGALLERDSYSFQQNALAQQQSHNSHNGDSQSFPVSPLSNSEKNLRHFQ 285

  Fly   475 QQTPVMNEC-----------IRSDSLESIGDVSS-----SLGNPPYIPAAPETTSSYPGS 518
            ||:|....|           :.:||.|:: ||:|     ...:...:..:...:.|.|||
 Frog   286 QQSPTAQNCLSTIAQDCAAGLNNDSPEAL-DVASLTDFNVFSSDSCLQLSDTVSPSLPGS 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 37/51 (73%)
hoxa2XP_004915456.1 Homeobox 144..197 CDD:365835 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.