DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxd10

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_031749087.1 Gene:hoxd10 / 100038085 XenbaseID:XB-GENE-485204 Length:274 Species:Xenopus tropicalis


Alignment Length:240 Identity:58/240 - (24%)
Similarity:102/240 - (42%) Gaps:50/240 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 YGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQ----CSSTEPPTNTALGLQELGLKLEKRIEEAV 274
            |.|.|.:...|....|.....|.::..|:..:    |:...||::.:.....:|.      ...:
 Frog    74 YRGTYPSYYPSEEVMHRDLIQPANRRSDMLFKSDSVCNHHGPPSSQSNFYSSVGR------NGIL 132

  Fly   275 PAG-----QQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMA 334
            |.|     ...|..|.::..::..:::|..:.........:.|:..:||:...            
 Frog   133 PQGFDQFYDSSQNQGYQVGMEEQPAKSDPKATNAPTKAPSTQDKKVTNDSSPG------------ 185

  Fly   335 ETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEI 399
             |..||            |..:|.|....:  :::|..|:::||.|||:||.:|.|:.:.:|:::
 Frog   186 -TPSGE------------AEKSNSSASQRL--RKKRCPYSKYQIRELEREFFFNVYINKEKRLQL 235

  Fly   400 AHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNP 444
            :..|.|::||:||||||||||.||.|        |.:.....|||
 Frog   236 SRMLNLTDRQVKIWFQNRRMKEKKLN--------RDRLQYFTGNP 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 26/51 (51%)
hoxd10XP_031749087.1 DUF3528 41..163 CDD:403310 16/94 (17%)
Homeobox 205..259 CDD:395001 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.