DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and cdx1b

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001092232.1 Gene:cdx1b / 100004956 ZFINID:ZDB-GENE-070615-29 Length:255 Species:Danio rerio


Alignment Length:340 Identity:89/340 - (26%)
Similarity:114/340 - (33%) Gaps:149/340 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 SSNYANA---------------TPPSHPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYG 177
            ||.|.|:               .||.:|         ...||  ||.|. |:....|...|..:.
Zfish    11 SSMYPNSVRHPSLNLNPQNFVPAPPQYP---------DFTGY--HHVPG-ITTNDPHHSQTGSWN 63

  Fly   178 PAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDL 242
            ||...|...                        :..||.|.|.::.|.|..   |.||.      
Zfish    64 PAYPPPREE------------------------WTPYGPGSGVSSSSTGQL---GFSPP------ 95

  Fly   243 PLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLML 307
              :.||.:.|          || |:..|..:|   .||.....|                     
Zfish    96 --EFSSVQTP----------GL-LQSSINSSV---GQLSPNAQR--------------------- 123

  Fly   308 DRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRT- 371
             |:|                                |.||::         |..|.....:.|| 
Zfish   124 -RNP--------------------------------YDWMRR---------SVPPASSGGKTRTK 146

  Fly   372 -----AYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTK 431
                 .||.||.|||||||||:||:|.||:.|:|..|.|||||:||||||||.|.:|.||    |
Zfish   147 DKYRVVYTDHQRLELEKEFHYSRYITIRRKAELATALSLSERQVKIWFQNRRAKERKINK----K 207

  Fly   432 NVRKKTVDANGNPTP 446
            .:::....:...|||
Zfish   208 KMQQPQPASTTTPTP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 37/57 (65%)
cdx1bNP_001092232.1 Caudal_act 13..132 CDD:282574 41/233 (18%)
Homeobox 150..202 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.