DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and KIRREL3

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_011541328.1 Gene:KIRREL3 / 84623 HGNCID:23204 Length:809 Species:Homo sapiens


Alignment Length:309 Identity:69/309 - (22%)
Similarity:124/309 - (40%) Gaps:52/309 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AISLDSVLSAPVISQISKDVVASVGDS-VEFNCTVE-EVGQLSVSWAKRPSESDTNSVVLSMRNI 85
            ::::|  :..|.:..:|.:....:.|: |.|:|:.: ........||||.            :.|
Human   247 SVTID--IQHPPLVNLSVEPQPVLEDNVVTFHCSAKANPAVTQYRWAKRG------------QII 297

  Fly    86 LSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIA 150
            .....:.|..||.         ||:..:        |..|:| .:|........::.:...|.:.
Human   298 KEASGEVYRTTVD---------YTYFSE--------PVSCEV-TNALGSTNLSRTVDVYFGPRMT 344

  Fly   151 ENTPKSTLVTEGQNLELTCHANGFPKPTISWAREHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYY 215
             ..|:|.||..|.:...:|...|.|..||.|.:..:.|:     |..|.||.::||.:.|.|.|.
Human   345 -TEPQSLLVDLGSDAIFSCAWTGNPSLTIVWMKRGSGVV-----LSNEKTLTLKSVRQEDAGKYV 403

  Fly   216 C---IAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVV---WHKN 274
            |   :.:.|.|:   |.:.:.|...|.|:..:.:.| :.....:::|.::..|.|..:   |.:|
Human   404 CRAVVPRVGAGE---REVTLTVNGPPIISSTQTQHA-LHGEKGQIKCFIRSTPPPDRIAWSWKEN 464

  Fly   275 GVPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYY-CNATNKLG 322
            .:...:|..:.|...::..| ..|.|.|.::...||...| |.|.|..|
Human   465 VLESGTSGRYTVETISTEEG-VISTLTISNIVRADFQTIYNCTAWNSFG 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 20/111 (18%)
Ig 37..127 CDD:299845 17/91 (19%)
IG_like 154..234 CDD:214653 25/82 (30%)
IGc2 161..223 CDD:197706 19/64 (30%)
I-set 254..330 CDD:254352 18/73 (25%)
IGc2 254..322 CDD:197706 17/71 (24%)
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845
IG_like 60..149 CDD:214653
I-set 156..249 CDD:254352 0/1 (0%)
Ig2_KIRREL3-like 171..252 CDD:143236 1/6 (17%)
Ig_2 260..337 CDD:290606 19/106 (18%)
I-set 341..422 CDD:254352 26/89 (29%)
IGc2 355..406 CDD:197706 18/55 (33%)
Ig5_KIRREL3 424..521 CDD:143306 21/91 (23%)
IG_like 432..521 CDD:214653 19/83 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.