DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and opcml

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001072487.1 Gene:opcml / 779942 XenbaseID:XB-GENE-5831850 Length:346 Species:Xenopus tropicalis


Alignment Length:345 Identity:96/345 - (27%)
Similarity:144/345 - (41%) Gaps:56/345 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PDMARLRLLIGLIFCLAIS-LDSVLSAPVIS------QISKDVVASVGDSVEFNCTVEEVGQLSV 64
            |..|.|...:..:|..|:: |.|:...||.|      :...:|....|||....|||:. ....|
 Frog     5 PAAAHLYHHVCWMFGAALTVLLSITGVPVRSGDAGFPKAMDNVTVRQGDSAILRCTVDN-RVTRV 68

  Fly    65 SWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLV 129
            :|..|       |.:|...|.....|.|  |.:....|:.   |:..|||:::.|.|||.|.|..
 Frog    69 AWLNR-------STILYTGNDKWSIDPR--VVLLANTKSQ---YSIEIQNVDIYDEGPYTCSVQT 121

  Fly   130 SATEKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISW----AREHNAVMP 190
            ....| |.::.|.::..|.|. |......|.||..:.|.|.|.|.|:|.::|    .:.|..|..
 Frog   122 DNHPK-TSRVHLIVQVAPQIL-NISSDITVNEGSTVALRCLATGRPEPAVTWRHFTGKSHRFVSD 184

  Fly   191 AGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSA 255
                   :..|.|..:.|...|.|.|.|.|....||.|.:||.|.:.|.|:..|...|.: ....
 Frog   185 -------DEYLEITGITRDQSGQYECSAANDVSAPDIRKVRVTVNYPPYISDTRNTGASL-GQKG 241

  Fly   256 ELECSVQGYPAPTVVWHK---------NGVPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFG 311
            .|.||....|.....|::         :||.:::..|             .|:|...:|.|:|:|
 Frog   242 ILRCSASAVPLAEFQWYREETRLANGLDGVRIENKDH-------------MSILTFFNVSEKDYG 293

  Fly   312 DYYCNATNKLGHADARLHLF 331
            :|.|.|:||||:::|.:.|:
 Frog   294 NYTCVASNKLGNSNASVILY 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 33/115 (29%)
Ig 37..127 CDD:299845 26/89 (29%)
IG_like 154..234 CDD:214653 25/83 (30%)
IGc2 161..223 CDD:197706 19/65 (29%)
I-set 254..330 CDD:254352 22/84 (26%)
IGc2 254..322 CDD:197706 19/76 (25%)
opcmlNP_001072487.1 Ig 46..134 CDD:325142 30/101 (30%)
Ig_3 138..207 CDD:316449 22/76 (29%)
ig 228..312 CDD:278476 24/97 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.