DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and vsig10

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_012819722.1 Gene:vsig10 / 733840 XenbaseID:XB-GENE-5959353 Length:541 Species:Xenopus tropicalis


Alignment Length:266 Identity:62/266 - (23%)
Similarity:102/266 - (38%) Gaps:49/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LSVSWAKRPSESDTN-SVVLSMRNILS----LPDQRYNVTVTEGPKTGSAIY------TFRIQNI 115
            |:|....|..:.|.| ::.||..||..    ..|.|.:..:..|..:....:      :..|..:
 Frog    27 LAVQGYPRVCKGDVNETITLSCNNITEPTAWFKDNRSDPVLACGSDSSDGHFSRVDESSLVITML 91

  Fly   116 EVSDMGPYECQVLVSATEKVTKKLSLQIKTPP--VIA-----ENTPKSTLVT-EGQNLELTCHAN 172
            ::.|.|.|.|. ..|..:.....:.|::.:.|  |:|     ...|..||.| .|.||...|.::
 Frog    92 QIQDEGNYSCS-KCSEDKSSQDHIQLRVSSGPYNVLAAISPTRTLPNGTLYTFTGSNLSFGCSSS 155

  Fly   173 GFPKPTISWAREHNAVMP------AGGHLLAEPTLRIRSVHRMDRGGYYCIAQNG-EGQPDKRLI 230
            .:|.|.:....|.....|      .|.:.|   ...:.:|....:|.|.|.:.|. .||.::.  
 Frog   156 SYPAPDLEIVLERTDARPELFSSSKGKNFL---YFNLSNVASNYQGNYTCSSVNPLSGQTERS-- 215

  Fly   231 RVEVEFRPQIAVQRPKIAQMVSHS--------AELECSVQ-GYPAPTVVWHKNGVPLQSSRHHEV 286
                  ..|:.|.||.|:.:..::        .:|.||.. |||.|.:.|.::|..|.:...  |
 Frog   216 ------THQLLVYRPPISPVKCYADNSMGFSKMQLSCSWSGGYPDPLLQWEQDGKILANGSF--V 272

  Fly   287 ANTASS 292
            |||..:
 Frog   273 ANTTDT 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 19/91 (21%)
Ig 37..127 CDD:299845 17/75 (23%)
IG_like 154..234 CDD:214653 21/87 (24%)
IGc2 161..223 CDD:197706 15/68 (22%)
I-set 254..330 CDD:254352 14/48 (29%)
IGc2 254..322 CDD:197706 14/48 (29%)
vsig10XP_012819722.1 Ig 44..>101 CDD:319273 11/56 (20%)
IG_like 145..217 CDD:214653 17/82 (21%)
IG_like 331..412 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42757
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.