DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and CG34353

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:327 Identity:91/327 - (27%)
Similarity:151/327 - (46%) Gaps:27/327 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PDMARLRLLIGLIFCLAISLDSVL--SAPVISQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKR 69
            |.:..|.:.:..:...::|..|::  :.|:....|:......|:::...|.|.......|:|.: 
  Fly    58 PHILFLAIAVVSLHFESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTYVVAWKR- 121

  Fly    70 PSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEK 134
                  ...:|:..::...||.|  |.:..|       :..:|::...:|.|.|.||:......:
  Fly   122 ------GIAILTAGSVKVTPDPR--VRLVNG-------FNLQIRDALPTDAGDYICQIATMDPRE 171

  Fly   135 VTKKLSLQIKTPPVIAE-NTPKSTLVTEGQNLELTCHANGFPKPTISWAREHNAVMPAGGHLLAE 198
            :|.  :::|..||.|.. :|.....|.:|.::.:.|.|.|.|.|.::|:|::| ::|.|...|..
  Fly   172 ITH--TVEILVPPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTWSRKNN-ILPNGEEKLHS 233

  Fly   199 PTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQG 263
            ..|.|.:|.|...|.|.|.|.|..|||....:.:.|.|.|:|:|:||.:.....|.|.|.|.|.|
  Fly   234 HVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHG 298

  Fly   264 YPAPTVVWHKNGVPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHADARL 328
            ...|.|:|.|:.:.|.::..| :..|..|..|    |.|..|..:|||:|.|.|.|:||.|...|
  Fly   299 ETQPEVIWFKDTMQLDTTERH-IMETRGSRHT----LIIRKVHPQDFGNYSCVAENQLGKARKTL 358

  Fly   329 HL 330
            .|
  Fly   359 QL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 20/109 (18%)
Ig 37..127 CDD:299845 17/89 (19%)
IG_like 154..234 CDD:214653 25/79 (32%)
IGc2 161..223 CDD:197706 21/61 (34%)
I-set 254..330 CDD:254352 28/75 (37%)
IGc2 254..322 CDD:197706 24/67 (36%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 19/97 (20%)
Ig 103..177 CDD:143165 17/91 (19%)
IG_like 191..269 CDD:214653 25/78 (32%)
IGc2 198..258 CDD:197706 21/60 (35%)
I-set 273..360 CDD:254352 34/91 (37%)
Ig 290..359 CDD:143165 27/73 (37%)
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
32.810

Return to query results.
Submit another query.