DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and aebp1b

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_696022.6 Gene:aebp1b / 567630 ZFINID:ZDB-GENE-030131-8546 Length:1247 Species:Danio rerio


Alignment Length:311 Identity:62/311 - (19%)
Similarity:113/311 - (36%) Gaps:108/311 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VLSMRN-------ILSLPDQRYNVT-VTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKV 135
            :|.:||       .|||....:.|. :||..|: ...:|.|.|::|..:         |::.|.:
Zfish     1 MLGLRNQKTLVVLCLSLLVPSWEVNGLTEHSKS-EISHTDREQHVEDRN---------VTSVEDL 55

  Fly   136 TKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISWAREHNAVMPAGGHLLAE-- 198
                 ||:|..|      |.:| :..||:.:|.|..:...| .|:|      |.|.|..:|.:  
Zfish    56 -----LQVKIIP------PYAT-IEVGQHKQLLCKVSSDAK-NINW------VSPNGEKVLTKHG 101

  Fly   199 -----------PTLRIRSVHRMDRGGYYCIAQNGEGQP----------------------DKRLI 230
                       .:|.:.:.:..:.|.|.|:|.||:.:.                      :|||.
Zfish   102 NLKVHNHGSVLSSLTVLNANLNNAGIYKCVATNGDTESQATVKLDIILKRMRRDTDRKGREKRLK 166

  Fly   231 RVEVEFRPQIA--VQRPKI----------AQMVSHSAELECSVQGYPAPTVVWHKNGVPLQSSRH 283
            ..:...:|:.:  .::||.          .:....:.|...:|    |.|.|.....||::....
Zfish   167 EPKPSKKPKASKPTKKPKSEKKGKGEKGGKKKGKKNREESTTV----ATTTVAPTTTVPMEYEEF 227

  Fly   284 HE-----------VANTASSSGTTTS--------VLRIDSVGEED-FGDYY 314
            ::           .|.|.:.:.|||:        :..:|...:.| :.||:
Zfish   228 YDPEPDQYWDEDFPAETTTVARTTTTPTEKTKDFIPDMDEYSQPDSYDDYW 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 17/71 (24%)
Ig 37..127 CDD:299845 14/55 (25%)
IG_like 154..234 CDD:214653 23/114 (20%)
IGc2 161..223 CDD:197706 18/74 (24%)
I-set 254..330 CDD:254352 16/81 (20%)
IGc2 254..322 CDD:197706 16/81 (20%)
aebp1bXP_696022.6 Ig 56..147 CDD:299845 24/104 (23%)
IG_like 62..145 CDD:214653 21/96 (22%)
FA58C 402..555 CDD:238014
FA58C 403..556 CDD:214572
Peptidase_M14_like 577..1036 CDD:299699
Peptidase_M14NE-CP-C_like 1040..1115 CDD:200604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.