Sequence 1: | NP_731114.2 | Gene: | Ama / 40831 | FlyBaseID: | FBgn0000071 | Length: | 341 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_696022.6 | Gene: | aebp1b / 567630 | ZFINID: | ZDB-GENE-030131-8546 | Length: | 1247 | Species: | Danio rerio |
Alignment Length: | 311 | Identity: | 62/311 - (19%) |
---|---|---|---|
Similarity: | 113/311 - (36%) | Gaps: | 108/311 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 VLSMRN-------ILSLPDQRYNVT-VTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKV 135
Fly 136 TKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISWAREHNAVMPAGGHLLAE-- 198
Fly 199 -----------PTLRIRSVHRMDRGGYYCIAQNGEGQP----------------------DKRLI 230
Fly 231 RVEVEFRPQIA--VQRPKI----------AQMVSHSAELECSVQGYPAPTVVWHKNGVPLQSSRH 283
Fly 284 HE-----------VANTASSSGTTTS--------VLRIDSVGEED-FGDYY 314 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ama | NP_731114.2 | I-set | 33..143 | CDD:254352 | 17/71 (24%) |
Ig | 37..127 | CDD:299845 | 14/55 (25%) | ||
IG_like | 154..234 | CDD:214653 | 23/114 (20%) | ||
IGc2 | 161..223 | CDD:197706 | 18/74 (24%) | ||
I-set | 254..330 | CDD:254352 | 16/81 (20%) | ||
IGc2 | 254..322 | CDD:197706 | 16/81 (20%) | ||
aebp1b | XP_696022.6 | Ig | 56..147 | CDD:299845 | 24/104 (23%) |
IG_like | 62..145 | CDD:214653 | 21/96 (22%) | ||
FA58C | 402..555 | CDD:238014 | |||
FA58C | 403..556 | CDD:214572 | |||
Peptidase_M14_like | 577..1036 | CDD:299699 | |||
Peptidase_M14NE-CP-C_like | 1040..1115 | CDD:200604 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |