DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and chl1a

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_068072887.1 Gene:chl1a / 566148 ZFINID:ZDB-GENE-090313-201 Length:1310 Species:Danio rerio


Alignment Length:334 Identity:84/334 - (25%)
Similarity:134/334 - (40%) Gaps:72/334 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AISLDSVLSAPVISQISKD----VVASVGDSVEFNCTVEE-VGQLSVSWAKRPSESDTNSVVLSM 82
            |.|.::....|::.:..|:    :|.:.||||...|...: :....:.|.       ||    .:
Zfish   117 ATSEEAEFIVPMVPKFPKEKIEPIVVTEGDSVVLECNPPQGIPPWQLYWM-------TN----DL 170

  Fly    83 RNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDM-GPYECQVLVSATEKVTKKLSLQIKTP 146
            |:|      ..|..|:.| .:|:..::    |..|||. ..|.|.........:.:|..:.:|..
Zfish   171 RHI------EQNERVSMG-LSGNLYFS----NTLVSDSHDDYCCFASFFKIRTIVQKPRMVLKVK 224

  Fly   147 PV-----------IAENTP--------KSTLVTEGQNLELTCHANGFPKPTISWAR-----EHNA 187
            ||           :.|..|        .:|.:.:|:.|||.|.|.|.|.|.:.|.:     ....
Zfish   225 PVDAKQEDGDAKIVQERKPSILVPSSHSTTFLKKGEELELECIAEGLPTPEVEWIKIWGDLPKRT 289

  Fly   188 VMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQM-- 250
            .:...|.||..|.:|     ..|.|.|.|.|:|..|: |....:|||| .|....:.|..:|:  
Zfish   290 QIKNFGKLLTIPNIR-----EEDEGKYMCKAKNQHGE-DVHHFQVEVE-EPPSWQKEPLKSQLAW 347

  Fly   251 VSHSAELECSVQGYPAPTVVWHKNGVPLQS--SRHHEVANTASSSGTTTSVLRIDSVGEEDFGDY 313
            :.....:.||..|.|.||:.|.:||.||..  |.||::.:      ....:|:.:   ::|...|
Zfish   348 IGSDIHINCSATGKPQPTITWKRNGKPLDDFPSTHHKMLD------DRIIILKAE---QKDTAVY 403

  Fly   314 YCNATNKLG 322
            .|.|:||.|
Zfish   404 QCEASNKHG 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 24/115 (21%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 63..68 CDD:409353 1/4 (25%)
Ig strand E 101..112 CDD:409353 1/10 (10%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig_3 146..220 CDD:464046 25/97 (26%)
I-set 254..330 CDD:400151 22/71 (31%)
Ig strand B 255..259 CDD:409353 0/3 (0%)
Ig strand C 268..272 CDD:409353 1/3 (33%)
Ig strand E 298..302 CDD:409353 1/3 (33%)
Ig strand F 312..317 CDD:409353 2/4 (50%)
chl1aXP_068072887.1 Ig 32..125 CDD:472250 2/7 (29%)
Ig strand B 51..55 CDD:409396
Ig strand C 64..68 CDD:409396
Ig strand E 89..93 CDD:409396
Ig strand F 105..110 CDD:409396
Ig strand G 119..122 CDD:409396 1/2 (50%)
Ig 134..224 CDD:472250 24/111 (22%)
Ig strand B 148..152 CDD:409432 1/3 (33%)
Ig strand C 162..166 CDD:409432 0/3 (0%)
Ig strand E 185..189 CDD:409432 1/3 (33%)
Ig strand F 200..205 CDD:409432 2/4 (50%)
Ig strand G 216..219 CDD:409432 1/2 (50%)
Ig 250..331 CDD:472250 26/86 (30%)
Ig strand B 262..266 CDD:409394 3/3 (100%)
Ig strand C 275..279 CDD:409394 0/3 (0%)
Ig strand E 296..300 CDD:409394 2/3 (67%)
Ig strand F 310..315 CDD:409394 2/4 (50%)
Ig strand G 323..326 CDD:409394 0/2 (0%)
Ig 336..422 CDD:472250 24/86 (28%)
Ig strand B 352..356 CDD:409367 0/3 (0%)
Ig strand C 365..369 CDD:409367 1/3 (33%)
Ig strand E 389..393 CDD:409367 0/3 (0%)
Ig strand F 402..407 CDD:409367 2/4 (50%)
Ig strand G 415..418 CDD:409367
Ig 429..513 CDD:472250
Ig strand B 445..449 CDD:409544
Ig strand C 458..462 CDD:409544
Ig strand E 481..485 CDD:409544
Ig strand F 495..500 CDD:409544
Ig strand G 508..511 CDD:409544
Ig 517..617 CDD:472250
Ig strand B 536..540 CDD:409359
Ig strand C 553..557 CDD:409359
Ig strand E 576..580 CDD:409359
Ig strand F 590..595 CDD:409359
Ig strand G 603..606 CDD:409359
FN3 614..703 CDD:238020
fn3 717..797 CDD:394996
FN3 <783..1099 CDD:442628
FN3 1092..1172 CDD:238020
Bravo_FIGEY 1209..1290 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.