DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and robo4

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_689255.3 Gene:robo4 / 560765 ZFINID:ZDB-GENE-020809-1 Length:1134 Species:Danio rerio


Alignment Length:311 Identity:78/311 - (25%)
Similarity:126/311 - (40%) Gaps:32/311 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LDSVLSAPVISQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPD 90
            |.|.::.|.|.....|||..||.....:|..|...:.::.|.:.....||:.:....:.|: |||
Zfish    64 LVSEINLPRIVHHPSDVVVRVGSPATLSCRAEGNPEPTIQWLRNGQPLDTDKMDAQSQPIV-LPD 127

  Fly    91 -QRYNVTVTEGPKTGS--AIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAEN 152
             ..:..:|..|.|..|  |:|.               |....|.....::..||.|.........
Zfish   128 GSLFFFSVVPGRKGQSHEAVYA---------------CIAHNSIGNATSRNASLHIAALREDFRV 177

  Fly   153 TPKSTLVTEGQNLELTCHAN-GFPKPTISWAREHNAVMPAGGHLL-AEPTLRIRSVHRMDRGGYY 215
            .|....|..|:...:.|... |.|:|.::|.::...:..:..|.. .:..|.|....:.|.|.|.
Zfish   178 QPSDVEVAIGEMATINCSPPVGHPEPNVTWRKDGILINSSNEHYTELKGKLIIAPAQKNDSGVYS 242

  Fly   216 CIAQNGEGQPDKRLIRVEVEFRPQIAVQRPK-IAQMVSHSAELECSVQGYPAPTVVWHKNGVPLQ 279
            |||.|..|..:.|..|:.|..:| :.:::|: ::..:..||:..|...|.|.|::.|.:...||.
Zfish   243 CIASNMIGVRESRAARLSVLAKP-VLLRKPEDVSVQLGESAQFFCEADGDPMPSIEWSREQGPLP 306

  Fly   280 SSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHADARLHL 330
            :.|:  :.|...|       |:|..|..:|.|.|.|...||||.:.|...|
Zfish   307 NGRY--LINPDHS-------LQIHYVTAQDMGRYSCTVENKLGVSVASAQL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 26/112 (23%)
Ig 37..127 CDD:299845 21/92 (23%)
IG_like 154..234 CDD:214653 21/81 (26%)
IGc2 161..223 CDD:197706 16/63 (25%)
I-set 254..330 CDD:254352 24/75 (32%)
IGc2 254..322 CDD:197706 21/67 (31%)
robo4XP_689255.3 Ig1_Robo 70..169 CDD:143317 26/114 (23%)
I-set 71..168 CDD:254352 26/112 (23%)
I-set 175..261 CDD:254352 21/85 (25%)
Ig2_Robo 177..261 CDD:143201 21/83 (25%)
I-set 265..350 CDD:254352 27/94 (29%)
Ig 282..350 CDD:299845 24/76 (32%)
FN3 373..448 CDD:214495
FN3 472..560 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.