DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and nfascb

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_005162159.1 Gene:nfascb / 559590 ZFINID:ZDB-GENE-100519-2 Length:1166 Species:Danio rerio


Alignment Length:296 Identity:69/296 - (23%)
Similarity:120/296 - (40%) Gaps:45/296 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAI 107
            :|.:|:.:...|....|...|:.|.|...|                      :|:| |.|..:..
Zfish   245 IAMLGEELILECFAAGVPTPSIKWTKDYEE----------------------MTMT-GKKLENFN 286

  Fly   108 YTFRIQNIEVSDMGPYECQVLVSATEKVTKK---LSLQIKTPPVIAENTPKSTLVTEGQNLELTC 169
            .|.||:.|.:.|.|.|.|    :|:.::...   :::::|:.|...|. |:|.:::......:.|
Zfish   287 KTLRIKKIAMDDGGDYIC----TASNRMGSLDHIITVRVK
SVPFWLEK-PESLVLSRDDGGSMVC 346

  Fly   170 HANGFPKPTISWAREHNAVMPA---GGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIR 231
            .|:|.|:|.|.|......:..|   .|..::..||..|.|.......:.|.|.|..|........
Zfish   347 RADGIPRPQIQWLVNGEPISDAPRSPGRQVSGDTLTFRGVVPDSAAVFQCNASNPYGYIMTNAFL 411

  Fly   232 VEVEFRPQIAVQRPKIAQMVSHSAE-LECSVQGYPAPTVVWHKNGV-PLQSSRHHEVANTASSSG 294
            ..::.:|::...|.::.:....:.. |:|...|.|.|.:.|.|.|| .|:..|:..:.|     |
Zfish   412 AVMDMKPRLLGPRDELFKTTEGNLTLLDCPYFGSPKPVLRWSKGGVGTLEGGRYRTLPN-----G 471

  Fly   295 TTTSVLRIDSVGEEDFGDYYCNATNKLGHADARLHL 330
            |    |.|.:...:|.|.|.|.|:|.:|..:..:.|
Zfish   472 T----LEIRNTKLQDQGAYVCVASNVIGRDEKEVQL 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 21/102 (21%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..68 CDD:409353 2/4 (50%)
Ig strand E 101..112 CDD:409353 2/10 (20%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 136..139 CDD:409353 0/5 (0%)
Ig_3 146..220 CDD:464046 19/76 (25%)
I-set 254..330 CDD:400151 23/77 (30%)
Ig strand B 255..259 CDD:409353 1/4 (25%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 298..302 CDD:409353 1/3 (33%)
Ig strand F 312..317 CDD:409353 2/4 (50%)
nfascbXP_005162159.1 Ig 31..123 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand E 87..91 CDD:409353
Ig strand F 103..108 CDD:409353
Ig strand G 117..120 CDD:409353
Ig 132..222 CDD:472250
Ig strand B 146..150 CDD:409353
Ig strand C 160..164 CDD:409353
Ig strand E 183..187 CDD:409353
Ig strand F 198..203 CDD:409353
Ig strand G 214..217 CDD:409353
Ig 240..322 CDD:472250 21/103 (20%)
Ig strand B 252..256 CDD:409353 0/3 (0%)
Ig strand C 265..269 CDD:409353 1/3 (33%)
Ig strand E 287..291 CDD:409353 1/3 (33%)
Ig strand F 301..306 CDD:409353 2/8 (25%)
Ig strand G 314..317 CDD:409353 0/2 (0%)
Ig 326..414 CDD:472250 20/88 (23%)
Ig strand B 342..346 CDD:409353 0/3 (0%)
Ig strand C 355..359 CDD:409353 1/3 (33%)
Ig strand E 379..383 CDD:409353 2/3 (67%)
Ig strand F 393..398 CDD:409353 1/4 (25%)
Ig strand G 406..409 CDD:409353 0/2 (0%)
Ig 433..505 CDD:472250 24/80 (30%)
Ig strand B 436..440 CDD:409353 1/3 (33%)
Ig strand C 449..453 CDD:409353 0/3 (0%)
Ig strand E 471..475 CDD:409353 3/7 (43%)
Ig strand F 485..490 CDD:409353 2/4 (50%)
Ig strand G 498..501 CDD:409353 0/2 (0%)
Ig 510..596 CDD:472250
Ig strand B 526..530 CDD:409353
Ig strand C 541..545 CDD:409353
Ig strand E 563..566 CDD:409353
Ig strand F 576..581 CDD:409353
Ig strand G 589..592 CDD:409353
FN3 600..691 CDD:238020
FN3 <653..1024 CDD:442628
FN3 808..909 CDD:238020
Bravo_FIGEY 1045..1139 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.