DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and dpr12

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:222 Identity:51/222 - (22%)
Similarity:88/222 - (39%) Gaps:40/222 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SLDSVLSAPVISQ---ISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSV-------- 78
            :||| ..:|:...   ::.:....:|.:....|.|..|.::.|:|         |.:        
  Fly    68 NLDS-SDSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNW---------NQISWIRRRDW 122

  Fly    79 -VLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQ 142
             :||....|...|:|:.:..|    .||.::|.:|:.::..|.|.||||| .:.|..::..::||
  Fly   123 HILSSGAQLYTNDERFAILHT----PGSNMWTLQIKFVQRRDHGMYECQV-STPTGIISHFVNLQ 182

  Fly   143 IKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPT--ISWAREHNAV--MPAGGHLLAEPT--- 200
            :..|......:.: ..|..|..:.|.|.....|.|.  :.|.:....:  :.:...:..|.|   
  Fly   183 VVVPEAFILGSGE-LHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGP 246

  Fly   201 -----LRIRSVHRMDRGGYYCIAQNGE 222
                 |.||.....|.|.|.|.|.|.|
  Fly   247 RTQSRLIIREPQVTDSGNYTCSASNTE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 27/121 (22%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..68 CDD:409353 2/4 (50%)
Ig strand E 101..112 CDD:409353 3/10 (30%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig_3 146..220 CDD:464046 18/85 (21%)
I-set 254..330 CDD:400151
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 298..302 CDD:409353
Ig strand F 312..317 CDD:409353
dpr12NP_652462.3 IG_like 86..183 CDD:214653 26/110 (24%)
Ig strand B 95..99 CDD:409353 0/3 (0%)
Ig strand C 109..117 CDD:409353 3/16 (19%)
Ig strand E 149..153 CDD:409353 1/3 (33%)
Ig strand F 163..168 CDD:409353 3/4 (75%)
Ig strand G 176..179 CDD:409353 0/2 (0%)
Ig_3 195..271 CDD:464046 17/76 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.