DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and dpr6

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:290 Identity:63/290 - (21%)
Similarity:111/290 - (38%) Gaps:56/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTG 104
            ::|.|.:|.|...:|.|..:...:|||.:   ..|.:  :|::.:.....|||:..|..:..:. 
  Fly    81 RNVTALMGKSAYLSCRVRNLANKTVSWIR---HRDIH--ILTVGSYTYTSDQRFQATHHQDTED- 139

  Fly   105 SAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTC 169
               :|.:|:..:..|.|.||||:..........:|::.:.|..::.   .....|.:|..:.|||
  Fly   140 ---WTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVV
PTATILG---GPDLHVDKGSTINLTC 198

  Fly   170 HANGFPKPT--ISWAREHNAV----MPAGGHLLAE------PTLRIRSVHRMDRGGYYCIAQNGE 222
            .....|:|.  |.|......:    ...|..::.|      ..|.|::....|.|.|.|...|. 
  Fly   199 TVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNA- 262

  Fly   223 GQPDKRLIRVEV-EFRPQIAVQRPKIAQMVSHSAEL------------------ECSVQGYPAPT 268
               |...:||.| ..|..|:.:.|:..|..|...:.                  :|| ...||..
  Fly   263 ---DVASVRVHVLNVRAIISGEHPEAMQTGSSGCQYNWLTIVLLLGLVLCYSSQQCS-SAVPASL 323

  Fly   269 VVWHKNGVPLQSSRHHEVANTASSSGTTTS 298
            .    :.:||.|    ::...|:::.|||:
  Fly   324 T----SSLPLPS----QLPLPAAAAATTTA 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 24/102 (24%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..68 CDD:409353 3/4 (75%)
Ig strand E 101..112 CDD:409353 1/10 (10%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig_3 146..220 CDD:464046 17/85 (20%)
I-set 254..330 CDD:400151 11/63 (17%)
Ig strand B 255..259 CDD:409353 0/21 (0%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 298..302 CDD:409353 0/1 (0%)
Ig strand F 312..317 CDD:409353
dpr6NP_001287018.1 FR1 79..96 CDD:409355 4/14 (29%)
IG_like 80..175 CDD:214653 24/102 (24%)
Ig strand A' 83..85 CDD:409355 1/1 (100%)
Ig strand B 89..97 CDD:409355 2/7 (29%)
CDR1 97..104 CDD:409355 1/6 (17%)
FR2 105..114 CDD:409355 4/11 (36%)
Ig strand C 105..110 CDD:409355 3/7 (43%)
CDR2 115..129 CDD:409355 3/13 (23%)
Ig strand D 129..135 CDD:409355 1/5 (20%)
FR3 130..159 CDD:409355 8/32 (25%)
Ig strand E 139..145 CDD:409355 1/9 (11%)
Ig strand F 153..160 CDD:409355 5/6 (83%)
IG_like 184..271 CDD:214653 21/90 (23%)
Ig strand B 194..198 CDD:409353 1/3 (33%)
Ig strand C 209..213 CDD:409353 1/3 (33%)
Ig strand E 240..244 CDD:409353 1/3 (33%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig strand G 268..271 CDD:409353 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.