DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and OPCML

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001306032.1 Gene:OPCML / 4978 HGNCID:8143 Length:354 Species:Homo sapiens


Alignment Length:292 Identity:83/292 - (28%)
Similarity:126/292 - (43%) Gaps:22/292 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGS 105
            :|....|:|....||::: ....|:|..|       |.:|...|.....|.|..:.|....:   
Human    44 NVTVRQGESATLRCTIDD-RVTRVAWLNR-------STILYAGNDKWSIDPRVIILVNTPTQ--- 97

  Fly   106 AIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCH 170
              |:..|||::|.|.|||.|.|......| |.::.|.::.||.|. |......|.||.::.|.|.
Human    98 --YSIMIQNVDVYDEGPYTCSVQTDNHPK-TSRVHLIVQVPPQIM-NISSDITVNEGSSVTLLCL 158

  Fly   171 ANGFPKPTISWAREHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVE 235
            |.|.|:||::|  .|.:|....|.:..:..|.|..:.|...|.|.|.|.|....||.|.:::.|.
Human   159 AIGRPEPTVTW--RHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVN 221

  Fly   236 FRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHKNGVPLQSSRHHEVANTASSSGTTTSVL 300
            :.|.|: :.......|.....|.|.....|.....|.|....|.:.    :......:....|.|
Human   222 YPPYIS-KAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATG----LDGMRIENKGRMSTL 281

  Fly   301 RIDSVGEEDFGDYYCNATNKLGHADARLHLFQ 332
            ...:|.|:|:|:|.|.||||||:.:|.:.|::
Human   282 TFFNVSEKDYGNYTCVATNKLGNTNASITLYE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 28/101 (28%)
Ig 37..127 CDD:299845 24/85 (28%)
IG_like 154..234 CDD:214653 25/79 (32%)
IGc2 161..223 CDD:197706 21/61 (34%)
I-set 254..330 CDD:254352 21/75 (28%)
IGc2 254..322 CDD:197706 18/67 (27%)
OPCMLNP_001306032.1 Ig 44..132 CDD:416386 28/101 (28%)
Ig strand A' 44..49 CDD:409353 1/4 (25%)
Ig strand B 51..59 CDD:409353 2/7 (29%)
CDR1 59..63 CDD:409353 0/4 (0%)
FR2 64..70 CDD:409353 2/5 (40%)
Ig strand C 64..70 CDD:409353 2/5 (40%)
CDR2 71..83 CDD:409353 4/18 (22%)
Ig strand C' 72..76 CDD:409353 1/3 (33%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 13/38 (34%)
Ig strand D 87..94 CDD:409353 2/6 (33%)
Ig strand E 97..103 CDD:409353 1/10 (10%)
Ig strand F 110..118 CDD:409353 4/7 (57%)
CDR3 119..123 CDD:409353 0/3 (0%)
Ig strand G 123..132 CDD:409353 3/9 (33%)
FR4 125..132 CDD:409353 2/6 (33%)
Ig_3 135..206 CDD:404760 25/73 (34%)
Ig strand A 135..138 CDD:409353 2/2 (100%)
Ig strand A' 144..148 CDD:409353 0/3 (0%)
Ig strand B 151..160 CDD:409353 2/8 (25%)
Ig strand C 165..170 CDD:409353 3/6 (50%)
Ig strand C' 171..174 CDD:409353 1/2 (50%)
Ig strand F 198..206 CDD:409353 4/7 (57%)
Ig 224..312 CDD:416386 24/92 (26%)
putative Ig strand A 224..230 CDD:409353 2/6 (33%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 2/3 (67%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143428
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42757
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3058
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.