Sequence 1: | NP_731114.2 | Gene: | Ama / 40831 | FlyBaseID: | FBgn0000071 | Length: | 341 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001306032.1 | Gene: | OPCML / 4978 | HGNCID: | 8143 | Length: | 354 | Species: | Homo sapiens |
Alignment Length: | 292 | Identity: | 83/292 - (28%) |
---|---|---|---|
Similarity: | 126/292 - (43%) | Gaps: | 22/292 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 DVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGS 105
Fly 106 AIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCH 170
Fly 171 ANGFPKPTISWAREHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVE 235
Fly 236 FRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHKNGVPLQSSRHHEVANTASSSGTTTSVL 300
Fly 301 RIDSVGEEDFGDYYCNATNKLGHADARLHLFQ 332 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ama | NP_731114.2 | I-set | 33..143 | CDD:254352 | 28/101 (28%) |
Ig | 37..127 | CDD:299845 | 24/85 (28%) | ||
IG_like | 154..234 | CDD:214653 | 25/79 (32%) | ||
IGc2 | 161..223 | CDD:197706 | 21/61 (34%) | ||
I-set | 254..330 | CDD:254352 | 21/75 (28%) | ||
IGc2 | 254..322 | CDD:197706 | 18/67 (27%) | ||
OPCML | NP_001306032.1 | Ig | 44..132 | CDD:416386 | 28/101 (28%) |
Ig strand A' | 44..49 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 51..59 | CDD:409353 | 2/7 (29%) | ||
CDR1 | 59..63 | CDD:409353 | 0/4 (0%) | ||
FR2 | 64..70 | CDD:409353 | 2/5 (40%) | ||
Ig strand C | 64..70 | CDD:409353 | 2/5 (40%) | ||
CDR2 | 71..83 | CDD:409353 | 4/18 (22%) | ||
Ig strand C' | 72..76 | CDD:409353 | 1/3 (33%) | ||
Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
FR3 | 84..118 | CDD:409353 | 13/38 (34%) | ||
Ig strand D | 87..94 | CDD:409353 | 2/6 (33%) | ||
Ig strand E | 97..103 | CDD:409353 | 1/10 (10%) | ||
Ig strand F | 110..118 | CDD:409353 | 4/7 (57%) | ||
CDR3 | 119..123 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 123..132 | CDD:409353 | 3/9 (33%) | ||
FR4 | 125..132 | CDD:409353 | 2/6 (33%) | ||
Ig_3 | 135..206 | CDD:404760 | 25/73 (34%) | ||
Ig strand A | 135..138 | CDD:409353 | 2/2 (100%) | ||
Ig strand A' | 144..148 | CDD:409353 | 0/3 (0%) | ||
Ig strand B | 151..160 | CDD:409353 | 2/8 (25%) | ||
Ig strand C | 165..170 | CDD:409353 | 3/6 (50%) | ||
Ig strand C' | 171..174 | CDD:409353 | 1/2 (50%) | ||
Ig strand F | 198..206 | CDD:409353 | 4/7 (57%) | ||
Ig | 224..312 | CDD:416386 | 24/92 (26%) | ||
putative Ig strand A | 224..230 | CDD:409353 | 2/6 (33%) | ||
Ig strand B | 240..244 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 253..257 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 279..283 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 293..298 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 306..309 | CDD:409353 | 1/2 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165143428 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000150 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR42757 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3058 |
SonicParanoid | 1 | 1.000 | - | - | X97 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
8 | 7.880 |