DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and opcml

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:311 Identity:82/311 - (26%)
Similarity:131/311 - (42%) Gaps:53/311 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SQISKDVVASVGDSVEFNCTVE-EVGQLSVSWAKRPSESDTNSVVLSM--RNILSLPDQRYNVTV 97
            |.:..::....|||....|::: :|.:  |:|..|.:...|.:...|:  |.:|      .|..|
Zfish    36 SYLKDNITVRQGDSAVLKCSMDNKVSR--VAWLNRTTILFTGNEKWSLDPRVVL------LNTAV 92

  Fly    98 TEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTLVTEG 162
            .|        |:.:|.|:.:.|.|||.|.:|.:...:.| |:.|.::.|..|. |......|.||
Zfish    93 NE--------YSIKILNVNLYDEGPYVCSILTNKKPEST-KVHLIVQVPARIV-NVSTDVSVNEG 147

  Fly   163 QNLELTCHANGFPKPTISW---AREHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQ 224
            .|:.|.|.|.|.|:|:|.|   :.:.|.::..|.:      :.:..:.:...|.|.||..|....
Zfish   148 SNVSLMCLAIGRPEPSILWKFRSSKGNRIVTEGEY------VEMTGITKDMSGSYDCITSNDISP 206

  Fly   225 PDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHK---------NGVPLQS 280
            ||.|.::|.|.:.|.|:..| .....|.....|.|.....|.....|.|         |||.:::
Zfish   207 PDVRTVQVTVNYPPVISRAR-STGTAVGQKGVLWCEASAVPLADFQWFKGERRILNGFNGVKIEN 270

  Fly   281 SRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHADARLHLF 331
            ....             |:|...:|.|||:|:|.|.|.|.||..:|.:.|:
Zfish   271 KGKQ-------------SMLTFFNVSEEDYGNYTCVAINTLGITNASIILY 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 28/109 (26%)
Ig 37..127 CDD:299845 23/92 (25%)
IG_like 154..234 CDD:214653 23/82 (28%)
IGc2 161..223 CDD:197706 18/64 (28%)
I-set 254..330 CDD:254352 22/84 (26%)
IGc2 254..322 CDD:197706 19/76 (25%)
opcmlNP_001005580.1 Ig 41..129 CDD:299845 27/104 (26%)
IG_like 41..129 CDD:214653 27/104 (26%)
IG_like 139..216 CDD:214653 23/82 (28%)
IGc2 146..202 CDD:197706 17/61 (28%)
I-set 219..307 CDD:254352 26/101 (26%)
ig 223..307 CDD:278476 24/97 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576308
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42757
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3058
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.