DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and DIP-gamma

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:345 Identity:82/345 - (23%)
Similarity:141/345 - (40%) Gaps:69/345 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SQISKD---------VVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQ 91
            ||:..|         |....|......|:|..:|:..|.|.:.     ::..||:::..:...:.
  Fly    33 SQLDPDPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRA-----SDQTVLALQGRVVTHNA 92

  Fly    92 RYNVTVTEGPKTGSAIYTF--RIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTP 154
            |.:|...:       ::|:  :|..:..||.|.|.||:..|..:|....:.:|: .|.:|.|.:.
  Fly    93 RISVMHQD-------MHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQV-PPDIINEESS 149

  Fly   155 KSTLVTEGQNLELTCHANGFPKPTISWAREHNAVMPAGGHLLAEP--------------TLRIRS 205
            ....|.||::..|||.|.|.|:|.::|.||...::     |:.:|              :||:..
  Fly   150 ADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMI-----LIRKPGSRELMKVESYNGSSLRLLR 209

  Fly   206 VHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVV 270
            :.|...|.|.|||.|.......:.:.:.|:|.|.:......:...:....:|||.|:..|:|...
  Fly   210 LERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSY 274

  Fly   271 WHKNGVPLQSSRHHEVANTAS-SSGTTTSVLRID----------------------SVGEEDFGD 312
            |.|..   ::|......:||| .||:....:.:|                      |....|.|.
  Fly   275 WLKGA---RTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGT 336

  Fly   313 YYCNATNKLGHADARLHLFQ 332
            |:|.:||.||.|:..|.|::
  Fly   337 YHCVSTNSLGRAEGTLRLYE 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 24/117 (21%)
Ig 37..127 CDD:299845 20/100 (20%)
IG_like 154..234 CDD:214653 24/93 (26%)
IGc2 161..223 CDD:197706 23/75 (31%)
I-set 254..330 CDD:254352 26/98 (27%)
IGc2 254..322 CDD:197706 22/90 (24%)
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 21/103 (20%)
Ig 47..129 CDD:299845 20/93 (22%)
Ig 140..238 CDD:299845 27/102 (26%)
IG_like 247..355 CDD:214653 26/110 (24%)
Ig 256..351 CDD:299845 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
54.820

Return to query results.
Submit another query.