DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and klg

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster


Alignment Length:290 Identity:87/290 - (30%)
Similarity:136/290 - (46%) Gaps:29/290 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIY 108
            |.|||::...|.||.:|...:.|.:     .||  ||:..||:...|:|  |.:.:|       |
  Fly   112 AVVGDTLVLPCQVENLGNFVLLWRR-----GTN--VLTASNIMVTRDER--VRLIDG-------Y 160

  Fly   109 TFRIQNIEVSDMGPYECQVLVSATEKVTKKL--SLQIKTPP-VIAENTPKSTLVTEGQNLELTCH 170
            ...|.::|..|.|.|.||:    ::|:.:..  :::|..|| |.|..|.......:|..:.|.|.
  Fly   161 NLEISDLEPQDAGDYVCQI----SDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECK 221

  Fly   171 ANGFPKPTISWAREHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVE 235
            .:|.|.|:|.|.::..| ..:...:...|.|.:..:.|...|.|.|.|.||.|.|....:|::|.
  Fly   222 GSGNPVPSIYWTKKSGA-NKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVL 285

  Fly   236 FRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHKNGVPLQSSRHHEVANTASSSGTTTSVL 300
            :.|.|.|::..|.......|:|.|.|...|..||.|::|..|:||:....:|..|:     ..:|
  Fly   286 YPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRAN-----RHML 345

  Fly   301 RIDSVGEEDFGDYYCNATNKLGHADARLHL 330
            .|..:.:||||:|.|.|.|.||.:...:.|
  Fly   346 TIRHIQQEDFGNYSCVADNSLGRSRKYMEL 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 28/100 (28%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..68 CDD:409353 1/4 (25%)
Ig strand E 101..112 CDD:409353 1/10 (10%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig_3 146..220 CDD:464046 21/74 (28%)
I-set 254..330 CDD:400151 26/75 (35%)
Ig strand B 255..259 CDD:409353 2/3 (67%)
Ig strand C 268..272 CDD:409353 2/3 (67%)
Ig strand E 298..302 CDD:409353 1/3 (33%)
Ig strand F 312..317 CDD:409353 2/4 (50%)
klgNP_524454.2 IG_like 109..195 CDD:214653 29/102 (28%)
Ig strand B 118..122 CDD:409353 0/3 (0%)
Ig strand C 131..135 CDD:409353 0/3 (0%)
Ig strand E 160..164 CDD:409353 1/3 (33%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 0/2 (0%)
Ig_3 196..270 CDD:464046 21/74 (28%)
Ig_3 287..364 CDD:464046 27/81 (33%)
FN3 392..486 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.