DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and Dscam3

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:342 Identity:79/342 - (23%)
Similarity:133/342 - (38%) Gaps:72/342 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RPDMARLRLLIGLIFCLAI-SLDS--------VLSAPVISQISKDVVASVGDSVEFNCTVEEVGQ 61
            |||..      ||..|:|. |:.|        |...|.:..|. .:.|..|:.:..:|.......
  Fly   510 RPDDG------GLYKCVASNSMGSVQHSARLNVYGPPYVRAIG-PIKAVAGEDIIVHCPFAGYPV 567

  Fly    62 LSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNV-TVTEGPKTGSAIYTFRIQNIEVS-DMGPYE 124
            ..:.|.|...|..|::              .|.: :|.:|   |..:    |:|:|.. |.|.|.
  Fly   568 EQIRWEKAHQELTTSN--------------HYELASVADG---GQLV----IKNVEPGRDQGIYT 611

  Fly   125 CQVLVSATEKVTKKLSLQIKTPPVIAE-NTPKSTLVTEGQNLELTCHANGFPKPT-ISWAREHNA 187
            |.|...|.|:..:.:.|.:.:||||.. ..||:  :.||...::||..:....|. .||.::.::
  Fly   612 CIVRSRAGEEARRDMQLNVNSPPVIEPFKFPKN--LQEGGRAQITCAVSSGDMPIYFSWKKDDSS 674

  Fly   188 VMPAGGHLLAE-----PTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKI 247
            : |:...:..:     ..|..:.:.....|.|.|.|.|...:.: ....::|...|:...:....
  Fly   675 I-PSSLQITEKKEEFYSLLVFKDISARHSGKYTCYASNAAAKVN-YTAELQVRVAPRWRYEPMDT 737

  Fly   248 AQMVSHSAELECSVQGYPAPTVVW-------HKNGVPLQSSRHHEVANTASSSGTTTSVLRIDSV 305
            |.|:.::..:.|..:|||.||:.|       .|:..||....|..:.|.|:              
  Fly   738 AIMLGNTISINCEAEGYPIPTITWFKGQGKGSKDFKPLSMRNHSLLLNLAT-------------- 788

  Fly   306 GEEDFGDYYCNATNKLG 322
             :.|.|.|.|.|||::|
  Fly   789 -DNDEGYYMCQATNEIG 804

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 24/111 (22%)
Ig 37..127 CDD:299845 19/91 (21%)
IG_like 154..234 CDD:214653 16/85 (19%)
IGc2 161..223 CDD:197706 14/67 (21%)
I-set 254..330 CDD:254352 21/76 (28%)
IGc2 254..322 CDD:197706 20/74 (27%)
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165 9/28 (32%)
IGc2 553..619 CDD:197706 18/86 (21%)
I-set 634..724 CDD:254352 19/93 (20%)
ig 645..712 CDD:278476 13/67 (19%)
IG_like 734..815 CDD:214653 23/86 (27%)
Ig 745..815 CDD:299845 21/75 (28%)
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.