DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and dpr15

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster


Alignment Length:279 Identity:56/279 - (20%)
Similarity:99/279 - (35%) Gaps:93/279 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SVLSAPVISQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQR 92
            :.|..|......:.:::..|......|.|:::.:..:||.:.     .:..:|::.....:.|||
  Fly   185 TTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRM-----RDGHILTVDQTTFIADQR 244

  Fly    93 YNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTP--PVIAENTPK 155
            :....:..|:.    ::.:|:.:::.|.|.||||  ||...|.:..:.|:|..|  .:|.|:|..
  Fly   245 FQSVFSPNPER----WSLQIKYVQLKDEGTYECQ--VSTEPKASAIVHLRIVEPKTELIGESTRH 303

  Fly   156 STLVTEGQNLELTCHANGFPKPTISWAREHNAVMPAGGHLLAEPTLRI------RSVHRMDRGGY 214
               |..|..::|.|        .||.|              .||.|.|      :.::..:|.|:
  Fly   304 ---VKAGSQVKLRC--------IISQA--------------LEPPLFINWFYNQKQIYLHNRRGW 343

  Fly   215 YCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHKNGVPLQ 279
                            |.|:|              .:...||                   ||..
  Fly   344 ----------------RTEIE--------------RIDLPAE-------------------VPTT 359

  Fly   280 SSRHHEVANTASSSGTTTS 298
            |:.......|||::.||||
  Fly   360 STTTTTTTTTASTTTTTTS 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 22/109 (20%)
Ig 37..127 CDD:299845 16/89 (18%)
IG_like 154..234 CDD:214653 14/85 (16%)
IGc2 161..223 CDD:197706 12/67 (18%)
I-set 254..330 CDD:254352 12/45 (27%)
IGc2 254..322 CDD:197706 12/45 (27%)
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 21/102 (21%)
V-set 204..290 CDD:284989 21/96 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.