DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and dpr5

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:199 Identity:47/199 - (23%)
Similarity:84/199 - (42%) Gaps:23/199 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PVISQIS-KDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVT 96
            ||....: ::|:|::|.:...:|.|..:|..:|||.:   :.|.:.:.:.:....:  |||:...
  Fly    90 PVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIR---QRDLHILTIGIMTYTN--DQRFLAR 149

  Fly    97 VTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTLVTE 161
            ..:    .|..:..:|.:::..|.|.|||||.......:..||.:......::|.   :...:..
  Fly   150 HID----NSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILAN---RELFIQS 207

  Fly   162 GQNLELTCHANGFPKP--TISWAREHNAVMPA--GG------HLLAEPTLRIRSVHRMDRGGYYC 216
            |.::.|||.|...|.|  .:.|.::...|..:  ||      ..:....|.|..|...|.|.|.|
  Fly   208 GSDINLTCIAPQAPGPYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTC 272

  Fly   217 IAQN 220
            .|.|
  Fly   273 SADN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 26/110 (24%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..68 CDD:409353 3/4 (75%)
Ig strand E 101..112 CDD:409353 1/10 (10%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig_3 146..220 CDD:464046 20/83 (24%)
I-set 254..330 CDD:400151
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 298..302 CDD:409353
Ig strand F 312..317 CDD:409353
dpr5NP_650080.3 FR1 96..113 CDD:409355 3/16 (19%)
IG_like 98..179 CDD:214653 22/89 (25%)
Ig strand A' 100..102 CDD:409355 1/1 (100%)
Ig strand B 106..114 CDD:409355 1/7 (14%)
CDR1 114..120 CDD:409355 2/5 (40%)
FR2 121..132 CDD:409355 4/13 (31%)
Ig strand C 121..127 CDD:409355 3/8 (38%)
Ig strand C' 130..133 CDD:409355 0/2 (0%)
CDR2 133..146 CDD:409355 2/14 (14%)
Ig strand D 146..151 CDD:409355 0/4 (0%)
FR3 147..176 CDD:409355 7/32 (22%)
Ig strand E 155..162 CDD:409355 0/6 (0%)
Ig strand F 170..177 CDD:409355 5/6 (83%)
IG_like 206..278 CDD:214653 20/71 (28%)
Ig strand B 211..215 CDD:409353 1/3 (33%)
Ig strand C 226..230 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 1/3 (33%)
Ig strand F 269..274 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.