Sequence 1: | NP_731114.2 | Gene: | Ama / 40831 | FlyBaseID: | FBgn0000071 | Length: | 341 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650080.3 | Gene: | dpr5 / 41381 | FlyBaseID: | FBgn0037908 | Length: | 336 | Species: | Drosophila melanogaster |
Alignment Length: | 199 | Identity: | 47/199 - (23%) |
---|---|---|---|
Similarity: | 84/199 - (42%) | Gaps: | 23/199 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 PVISQIS-KDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVT 96
Fly 97 VTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTLVTE 161
Fly 162 GQNLELTCHANGFPKP--TISWAREHNAVMPA--GG------HLLAEPTLRIRSVHRMDRGGYYC 216
Fly 217 IAQN 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ama | NP_731114.2 | I-set | 33..143 | CDD:254352 | 26/110 (24%) |
Ig | 37..127 | CDD:299845 | 20/90 (22%) | ||
IG_like | 154..234 | CDD:214653 | 20/77 (26%) | ||
IGc2 | 161..223 | CDD:197706 | 20/70 (29%) | ||
I-set | 254..330 | CDD:254352 | |||
IGc2 | 254..322 | CDD:197706 | |||
dpr5 | NP_650080.3 | V-set | 95..191 | CDD:284989 | 24/104 (23%) |
IG_like | 98..179 | CDD:214653 | 22/89 (25%) | ||
IG_like | 206..278 | CDD:214653 | 20/71 (28%) | ||
Ig | 211..278 | CDD:143165 | 19/66 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |