DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and dpr16

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:268 Identity:53/268 - (19%)
Similarity:87/268 - (32%) Gaps:108/268 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LSAPVISQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRY- 93
            ||.|.:     :.....|......|.:.:.....:||.:...|.     ::::.:...:.|.|: 
  Fly   201 LSLPPL-----NATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEH-----IIAVDHTTFINDARFA 255

  Fly    94 ----NVTVT------------------------------EGPKTGSAIYTFRIQNIEVSDMGPYE 124
                :.|:|                              |...:.|..:|.:|:.:.:.|.|.||
  Fly   256 SLLQSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYE 320

  Fly   125 CQVLVSATE-KVTKKLSLQIKTP--PVIAENTPKSTLVTEGQNLELTCHANG---FPKPTISWAR 183
            ||:   ||| |::.|:.|.:.||  .:|.:   :...|..|..:||.|...|   .|| .|.|.|
  Fly   321 CQL---ATEPKMSAKVQLFVITPRTELIGD---RQRFVKAGSRVELHCIVRGTLEAPK-YIFWYR 378

  Fly   184 ------------------------------EHN------AVMPAGGHLLAEPTLRIRSVHRMDRG 212
                                          |||      .|:|.           :|.:|   .|
  Fly   379 GDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPL-----------VRKIH---SG 429

  Fly   213 GYYCIAQN 220
            .|.|..:|
  Fly   430 NYTCEPEN 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 26/145 (18%)
Ig 37..127 CDD:299845 18/124 (15%)
IG_like 154..234 CDD:214653 22/106 (21%)
IGc2 161..223 CDD:197706 21/99 (21%)
I-set 254..330 CDD:254352
IGc2 254..322 CDD:197706
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 25/144 (17%)
Ig <298..338 CDD:299845 15/42 (36%)
IG_like 352..447 CDD:214653 22/101 (22%)
Ig 358..439 CDD:143165 20/95 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.