Sequence 1: | NP_731114.2 | Gene: | Ama / 40831 | FlyBaseID: | FBgn0000071 | Length: | 341 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287169.1 | Gene: | dpr16 / 40619 | FlyBaseID: | FBgn0037295 | Length: | 488 | Species: | Drosophila melanogaster |
Alignment Length: | 268 | Identity: | 53/268 - (19%) |
---|---|---|---|
Similarity: | 87/268 - (32%) | Gaps: | 108/268 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 LSAPVISQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRY- 93
Fly 94 ----NVTVT------------------------------EGPKTGSAIYTFRIQNIEVSDMGPYE 124
Fly 125 CQVLVSATE-KVTKKLSLQIKTP--PVIAENTPKSTLVTEGQNLELTCHANG---FPKPTISWAR 183
Fly 184 ------------------------------EHN------AVMPAGGHLLAEPTLRIRSVHRMDRG 212
Fly 213 GYYCIAQN 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ama | NP_731114.2 | I-set | 33..143 | CDD:254352 | 26/145 (18%) |
Ig | 37..127 | CDD:299845 | 18/124 (15%) | ||
IG_like | 154..234 | CDD:214653 | 22/106 (21%) | ||
IGc2 | 161..223 | CDD:197706 | 21/99 (21%) | ||
I-set | 254..330 | CDD:254352 | |||
IGc2 | 254..322 | CDD:197706 | |||
dpr16 | NP_001287169.1 | IG_like | 205..337 | CDD:214653 | 25/144 (17%) |
Ig | <298..338 | CDD:299845 | 15/42 (36%) | ||
IG_like | 352..447 | CDD:214653 | 22/101 (22%) | ||
Ig | 358..439 | CDD:143165 | 20/95 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |