DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and dpr10

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:269 Identity:59/269 - (21%)
Similarity:98/269 - (36%) Gaps:81/269 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQR----YNVTVTEG 100
            :::.:.||.|....|.|:.:|..:|:|.:   ..|.:  :|::.......|||    |:..:.| 
  Fly    61 RNITSLVGKSAYLGCRVKHLGNKTVAWIR---HRDLH--ILTVGTYTYTTDQRFQTSYHRDIDE- 119

  Fly   101 PKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLS----LQIKTPPV-----------IA 150
                   :|.:|:..:..|.|.||||:........:..|:    :..:|..:           ||
  Fly   120 -------WTLQIKWAQQRDAGVYECQ
ISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIA 177

  Fly   151 EN---------------------TPKSTL-------VTEGQNLELTCHANGFPKPT--ISWAREH 185
            ||                     .|.:|:       |.:|..:.|||.....|:|.  |.|..:.
  Fly   178 ENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQD 242

  Fly   186 NAVM--PAGGHL-----LAEPTLRIRSVHRMD---RGGYYCIAQNGEGQPDKRLIRVEVEFRPQI 240
            ..:.  .:||.|     .:|.|..|..::..|   .|.|.|...|.|    ...|||.|     :
  Fly   243 KVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTE----IASIRVHV-----L 298

  Fly   241 AVQRPKIAQ 249
            ..:||:..|
  Fly   299 QGERPEAMQ 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 24/110 (22%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..68 CDD:409353 2/4 (50%)
Ig strand E 101..112 CDD:409353 1/10 (10%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig_3 146..220 CDD:464046 25/124 (20%)
I-set 254..330 CDD:400151
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 298..302 CDD:409353
Ig strand F 312..317 CDD:409353
dpr10NP_729591.1 Ig 53..138 CDD:472250 21/89 (24%)
Ig strand B 71..75 CDD:409371 0/3 (0%)
Ig strand E 120..124 CDD:409371 1/3 (33%)
Ig_3 214..287 CDD:464046 19/72 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.