DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and dpr13

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:224 Identity:53/224 - (23%)
Similarity:95/224 - (42%) Gaps:36/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LDSVLSAPVI--SQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSL 88
            ::|:...|:.  ::.|..|...:|.:....|||..:|:..|||.::   .|.:.:.:.:....| 
  Fly   167 MESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRK---KDYHLLTVGLTTYSS- 227

  Fly    89 PDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSL-----QIKTPPV 148
             |:|::.|..:    .|..:|.:|:.:::.|.|.|||||.......:...||:     :|..||:
  Fly   228 -DERFSATHLK----HSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPPI 287

  Fly   149 IAENTPKSTLVTEGQNLELTCHA--NGFPKPTISWAREHNAV---MPAGGHLLAEP-----TLRI 203
                    ..:|.|..|.|.|..  |......|.|..::..:   :..|.::..||     .|.|
  Fly   288 --------RYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTI 344

  Fly   204 RSVHRMDRGGYYCIAQNGEGQPDKRLIRV 232
            :...|...|.:.|:|.|  .||...|:.:
  Fly   345 QRTRREHSGNFTCVASN--TQPASVLVHI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 28/116 (24%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..68 CDD:409353 3/4 (75%)
Ig strand E 101..112 CDD:409353 2/10 (20%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig_3 146..220 CDD:464046 19/83 (23%)
I-set 254..330 CDD:400151
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 298..302 CDD:409353
Ig strand F 312..317 CDD:409353
dpr13NP_001033956.2 V-set 180..276 CDD:462230 27/104 (26%)
Ig_3 281..361 CDD:464046 20/87 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.