DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and dscamb

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_009289749.1 Gene:dscamb / 386937 ZFINID:ZDB-GENE-031118-67 Length:2020 Species:Danio rerio


Alignment Length:315 Identity:83/315 - (26%)
Similarity:140/315 - (44%) Gaps:49/315 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLP-DQRYNVTVTEGPKT 103
            |:|.|..|.....:|.:......|:.|.|     |:|          .|| :.|.......|   
Zfish   511 KNVTAIAGRDTYIHCRIIGYPYYSIKWYK-----DSN----------LLPFNHRQRAFENNG--- 557

  Fly   104 GSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELT 168
                 |.::.|::.||.|.|.|.|||...:::.:.:.:.:|.||:|..:..:|..:  ||.:.:.
Zfish   558 -----TLKLSNVQNSDEGEYTCYVLVDPEKQIHRSVHVTVKVPPLIQHSDSQSASI--GQRVFIP 615

  Fly   169 CHA-NGFPKPTISWAREHNAVMPAGG----HLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKR 228
            |.. :|....:|:|.::...:..:.|    ::....:|||.::..:..|.|.|||:| |....:.
Zfish   616 CVVISGDLPMSITWHKDGRPINASLGVTIDNIDFTSSLRISNLSEIHNGSYTCIARN-EAAAVEH 679

  Fly   229 LIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHKN---GVPLQSSRHHEVANTA 290
            .|::.|:..|...||......:...|..|.||.:|.|.||:||:.:   |||       :....|
Zfish   680 SIQLIVKVPPHFEVQPKDQDGIYGKSVTLNCSAKGNPIPTIVWNHSKGAGVP-------QFQPIA 737

  Fly   291 SSSGTTTSVLR-----IDSVGEEDFGDYYCNATNKLGHADARLHLFQTVIPVPSL 340
            .:||:...:|.     |..|.|||.|.|.|..:|.:| ||....::.|| .:|::
Zfish   738 LNSGSRVQLLENGSLLIKHVLEEDAGFYLCKVSNDVG-ADISKSMYLTV-KIPAM 790

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 24/103 (23%)
Ig 37..127 CDD:299845 21/87 (24%)
IG_like 154..234 CDD:214653 19/84 (23%)
IGc2 161..223 CDD:197706 16/66 (24%)
I-set 254..330 CDD:254352 29/83 (35%)
IGc2 254..322 CDD:197706 26/75 (35%)
dscambXP_009289749.1 I-set 132..198 CDD:254352
I-set 225..310 CDD:254352
IGc2 239..300 CDD:197706
IG_like 320..400 CDD:214653
IGc2 328..391 CDD:197706
IG_like 417..501 CDD:214653
Ig 424..498 CDD:143165
IG_like 511..592 CDD:214653 24/103 (23%)
IGc2 518..576 CDD:197706 18/80 (23%)
I-set 595..685 CDD:254352 22/92 (24%)
Ig 612..682 CDD:143165 15/70 (21%)
I-set 689..785 CDD:254352 32/103 (31%)
Ig7_DSCAM 706..785 CDD:143211 28/86 (33%)
IG_like 795..883 CDD:214653
Ig 803..890 CDD:299845
FN3 887..980 CDD:238020
FN3 987..1084 CDD:238020
FN3 1092..1185 CDD:238020
FN3 1190..1279 CDD:238020
IGc2 1302..1367 CDD:197706
FN3 1398..1471 CDD:238020
FN3 1485..1557 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.