DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and wrapper

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:359 Identity:88/359 - (24%)
Similarity:154/359 - (42%) Gaps:66/359 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LIGLIFCLAISLDSVLSAPVISQISKDVVASVGDSVEFNCTVEEVGQL-SVSWAKRPSESDTNSV 78
            :..::.||       |:|.::.|:..:        ::||..:|...:. |:....:..|:||..:
  Fly     5 MCSVVRCL-------LAALILGQVQAE--------LDFNNDLENSQKFKSIPTTVKTYENDTVQL 54

  Fly    79 VLSM----------RNILSLPDQRYNVTVTEGPKTGSAIY----TFRIQNIEVSDMGPYECQVLV 129
            ..::          |:.::|.|.|:    .|.|.....:.    :.::.|::.||.|.|.|: :.
  Fly    55 PCTLNTPFRYVRWHRDDVALVDSRH----PELPPPDRIMLWPNGSLQVANVQSSDTGDYYCE-MN 114

  Fly   130 SATEKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISWAREHNAVMPAGG- 193
            |.:..|.::.:::::..|.:.......|....|...|:.|.|.|.|:|.|:|....|.:.|... 
  Fly   115 SDSGHVVQQHAIEVQLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITWRLNGNVIQPQSNT 179

  Fly   194 ----HLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHS 254
                .|:    |.|:|  |...|...|:|.||.|:|....:.:.|.|.|::::.:|.:...:...
  Fly   180 GNRQSLI----LEIKS--RNQAGLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVVYTKLGSR 238

  Fly   255 AELECSVQGYPAPTVVWHKNGVPLQSSRH---HEVANTASSSGTTTSV----------LRIDSVG 306
            |.|||.|:..||.||.|..:|:|:....|   ||     |...|..||          |.:.||.
  Fly   239 AHLECIVEAAPAATVKWFHHGLPVALGAHSTTHE-----SELQTNRSVDHYVNAVRHMLVVKSVR 298

  Fly   307 EEDFGDYYCNATNKLGHADARLHLFQTVIPVPSL 340
            ..|.|.|.|.|:|::......:.|  |..|:|.|
  Fly   299 NADMGQYECRASNQISVKSGSVEL--TGRPMPCL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 22/124 (18%)
Ig 37..127 CDD:299845 20/104 (19%)
IG_like 154..234 CDD:214653 24/84 (29%)
IGc2 161..223 CDD:197706 21/66 (32%)
I-set 254..330 CDD:254352 28/88 (32%)
IGc2 254..322 CDD:197706 28/80 (35%)
wrapperNP_477404.1 Ig 41..124 CDD:299845 17/87 (20%)
IG_like 41..118 CDD:214653 16/81 (20%)
IG_like 145..218 CDD:214653 23/78 (29%)
Ig 147..219 CDD:299845 23/77 (30%)
I-set 224..323 CDD:254352 30/105 (29%)
IGc2 236..314 CDD:197706 28/82 (34%)
FN3 339..431 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.