DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and DIP-theta

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:35 Identity:11/35 - (31%)
Similarity:16/35 - (45%) Gaps:7/35 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   591 IKSLTQANISFLE--YYKVNN-----SGFAPLPTG 618
            |.:|:..|.:||.  |:..||     ....|:|.|
  Fly     7 IANLSIRNAAFLSRGYHGPNNFRVYTMNDMPVPEG 41

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151
Ig strand B 50..54 CDD:409353
Ig strand C 63..68 CDD:409353
Ig strand E 101..112 CDD:409353
Ig strand F 122..127 CDD:409353
Ig strand G 136..139 CDD:409353
Ig_3 146..220 CDD:464046
I-set 254..330 CDD:400151
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 298..302 CDD:409353
Ig strand F 312..317 CDD:409353
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653
Ig strand B 147..151 CDD:409353
Ig strand C 160..164 CDD:409353
Ig strand E 195..199 CDD:409353
Ig strand F 209..214 CDD:409353
Ig strand G 221..224 CDD:409353
Ig 232..324 CDD:472250
Ig strand B 251..255 CDD:409275
Ig strand C 264..268 CDD:409275
Ig strand E 289..293 CDD:409275
Ig strand F 303..308 CDD:409275
Ig strand G 317..320 CDD:409275
Ig_3 327..408 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.