DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and dpr4

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:269 Identity:65/269 - (24%)
Similarity:103/269 - (38%) Gaps:48/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SAPVISQIS-KDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYN 94
            |.|.....| ::|.|:||.:...:|.|..:|..:|||.::.........:|:..|     |||:.
  Fly    43 SQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTN-----DQRFQ 102

  Fly    95 VTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTK--KLSLQIKTPPVIAENTPKST 157
            ...:|    ||..:|.||.:.:..|.|.||||  ||...|:::  :|::.:....::..   ...
  Fly   103 SLHSE----GSDEWTLRISSPQPRDSGTYECQ--VSTEPKISQGFRLNVVVSRAKILGN---AEL 158

  Fly   158 LVTEGQNLELTCHANGFPKPT--ISW---AREHNAVMPAGGHLLAEPTLR-----IRSVHRMDRG 212
            .:..|.::.|||.|...|.|.  |.|   .|..|.....|.:::.|.:.|     |......|.|
  Fly   159 FIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSG 223

  Fly   213 GYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAP---------- 267
            .|.|    .....|...:.|.|     |..:.|...|..:.||.....:.....|          
  Fly   224 NYTC----SPSSSDSASVVVHV-----INGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWMSMT 279

  Fly   268 --TVVWHKN 274
              :|.|:.|
  Fly   280 VASVAWNSN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 33/112 (29%)
Ig 37..127 CDD:299845 27/90 (30%)
IG_like 154..234 CDD:214653 21/89 (24%)
IGc2 161..223 CDD:197706 19/71 (27%)
I-set 254..330 CDD:254352 6/33 (18%)
IGc2 254..322 CDD:197706 6/33 (18%)
dpr4NP_001014616.2 V-set 53..146 CDD:284989 31/103 (30%)
IG_like 53..145 CDD:214653 31/102 (30%)
ig 153..227 CDD:278476 18/76 (24%)
IG_like 161..>227 CDD:214653 18/65 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.