DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and CG6867

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster


Alignment Length:185 Identity:58/185 - (31%)
Similarity:87/185 - (47%) Gaps:10/185 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 PPVIAE----NTPKSTLVTEGQNLELTCHANGFPKPTISWAREHNAVMPAGGHLLAEPT---LRI 203
            ||.|.:    :..::.:|.||::|.|:|.|.|.|.|.:.|.||....:...|..:|..:   ||.
  Fly   430 PPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISGQFLRF 494

  Fly   204 RSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPT 268
            .::.|.....|.|.|.||..........|||:|.|.|:|.|..|......||.|||.|:.:|...
  Fly   495 TNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAFPEAI 559

  Fly   269 VVWHK--NGVPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYCNATNKL 321
            ..|.:  :|..|..|..:.:.:......||.. |.|.::.::|||.|:|.|.|:|
  Fly   560 RYWERAYDGKILDPSDKYGIESYPEGFKTTMR-LTISNLRKDDFGYYHCVARNEL 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352
Ig 37..127 CDD:299845
IG_like 154..234 CDD:214653 24/82 (29%)
IGc2 161..223 CDD:197706 22/64 (34%)
I-set 254..330 CDD:254352 23/70 (33%)
IGc2 254..322 CDD:197706 23/70 (33%)
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653 24/82 (29%)
IGc2 449..511 CDD:197706 20/61 (33%)
IG_like 544..612 CDD:214653 21/68 (31%)
Ig 546..612 CDD:143165 20/66 (30%)
OLF 694..937 CDD:280371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.