DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and dpr8

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:209 Identity:51/209 - (24%)
Similarity:83/209 - (39%) Gaps:28/209 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPK 102
            |..::...||.:|:..|.|:.:|..:|||.:   ..|.:  :|::.......|||:.  ....|.
  Fly    48 IGTNITGLVGKTVKLTCRVKNLGNRTVSWVR---HRDIH--LLTVGRYTYTSDQRFE--AMHSPH 105

  Fly   103 TGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLEL 167
            ...  :|.||:..:..|.|.||||  :|.|..:...:.|.|..|.......|: ..:..|..:.|
  Fly   106 AED--WTLRIRYAQRKDSGIYECQ--ISTTPPIGHSVYLNIVEPVTDIIGGPE-LHINRGSTINL 165

  Fly   168 TCHANGFPK--PTISWAREHNAV---MPAGG-------HLLAEPTLRIRSVHRMDRGGYYCIAQN 220
            ||.....|:  ||:.|:.....:   .|.||       .:|....|.::.....|.|.|.|...|
  Fly   166 TCIVKFAPEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSN 230

  Fly   221 GEGQPDKRLIRVEV 234
            .    :...:||.:
  Fly   231 A----NPTSVRVHI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 28/104 (27%)
Ig 37..127 CDD:299845 24/88 (27%)
IG_like 154..234 CDD:214653 21/91 (23%)
IGc2 161..223 CDD:197706 18/73 (25%)
I-set 254..330 CDD:254352
IGc2 254..322 CDD:197706
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 25/90 (28%)
V-set 52..143 CDD:284989 27/101 (27%)
IG_like 153..238 CDD:214653 19/89 (21%)
ig 153..232 CDD:278476 19/83 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.