DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and Negr1

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_036019026.1 Gene:Negr1 / 320840 MGIID:2444846 Length:362 Species:Mus musculus


Alignment Length:329 Identity:96/329 - (29%)
Similarity:151/329 - (45%) Gaps:34/329 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLIGLIFCLAI--SLDSVLSAPVISQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTN 76
            :|:.|..||..  |:|...:|      ..:::...||:....|.:|: |....:|..|      :
Mouse    18 VLLSLCSCLPAGQSVDFPWAA------VDNMLVRKGDTAVLRCYLED-GASKGAWLNR------S 69

  Fly    77 SVVLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSL 141
            |::.:..:..|: |.|.:::.     .....|:.:|||::|:|.|||.|.|....|.: |.::.|
Mouse    70 SIIFAGGDKWSV-DPRVSIST-----LNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPR-TMQVHL 127

  Fly   142 QIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISWAREHNAVMPAGGHLLAEPTLRIRSV 206
            .::.||.|.:.:...| :.||.|:.|||.|.|.|:|.|||..    :.|:.........|.|..:
Mouse   128 TVQVPPKIYDISNDMT-INEGTNVTLTCLATGKPEPVISWRH----ISPSAKPFENGQYLDIYGI 187

  Fly   207 HRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMV-SHSAELECSVQGYPAPTVV 270
            .|...|.|.|.|:|....||.:.:||.|.|.|  .:|..|...:. ..|..:.|...|.|.|...
Mouse   188 TRDQAGEYECSAENDVSFPDVKKVRVIVNFAP--TIQEIKSGTVTPGRSGLIRCEGAGVPPPAFE 250

  Fly   271 WHKNGVPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHADARLHLFQTVI 335
            |:|....|.:.:...:....|    |.|:|.:.:|.:|.||:|.|.|.||||..:|.|.|.|.:.
Mouse   251 WYKGEKRLFNGQQGIIIQNFS----TRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNQIIE 311

  Fly   336 PVPS 339
            |..|
Mouse   312 PTTS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 25/109 (23%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..68 CDD:409353 1/4 (25%)
Ig strand E 101..112 CDD:409353 1/10 (10%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 136..139 CDD:409353 1/2 (50%)
Ig_3 146..220 CDD:464046 25/73 (34%)
I-set 254..330 CDD:400151 25/75 (33%)
Ig strand B 255..259 CDD:409353 0/3 (0%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 298..302 CDD:409353 2/3 (67%)
Ig strand F 312..317 CDD:409353 2/4 (50%)
Negr1XP_036019026.1 IG_like 41..129 CDD:214653 25/101 (25%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 62..66 CDD:409353 0/3 (0%)
Ig strand E 95..99 CDD:409353 1/3 (33%)
Ig strand F 109..114 CDD:409353 3/4 (75%)
Ig strand G 122..125 CDD:409353 1/2 (50%)
Ig_3 132..201 CDD:464046 25/73 (34%)
IG_like 225..306 CDD:214653 26/84 (31%)
Ig strand B 235..239 CDD:409353 0/3 (0%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.