DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and dpr14

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:205 Identity:52/205 - (25%)
Similarity:80/205 - (39%) Gaps:43/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGS 105
            ::...:..||..:|.|.::...:|||.:|  ..|..:::...::..| .|.||::...| |..  
  Fly    83 NISTQLSSSVYLHCRVNDLQGKTVSWMRR--RGDDLTLITFGQHTYS-GDSRYSLEFEE-PND-- 141

  Fly   106 AIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPV-IAENTPKST---LVTEGQNLE 166
              :...||.....|.||||||  ||:...:...:.|.|..|.| |.:....:|   ....|..:|
  Fly   142 --WKLLIQFANERDEGPYECQ--VSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIE 202

  Fly   167 LTCHANGFPKPT--ISWAREHNAVMPAGGHLLAEPTLR-------------------IRSVHRMD 210
            |.|..:..|.|:  |:|..        |..||...|.|                   |.:.:|.|
  Fly   203 LQCVISKIPHPSSYITWRH--------GPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQD 259

  Fly   211 RGGYYCIAQN 220
            .|.|.|:..|
  Fly   260 TGNYTCMLGN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 27/101 (27%)
Ig 37..127 CDD:299845 23/85 (27%)
IG_like 154..234 CDD:214653 21/91 (23%)
IGc2 161..223 CDD:197706 20/81 (25%)
I-set 254..330 CDD:254352
IGc2 254..322 CDD:197706
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 25/89 (28%)
Ig 84..169 CDD:299845 26/94 (28%)
IG_like 191..279 CDD:214653 20/87 (23%)
Ig 201..274 CDD:143165 19/77 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.