Sequence 1: | NP_731114.2 | Gene: | Ama / 40831 | FlyBaseID: | FBgn0000071 | Length: | 341 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001245573.1 | Gene: | dpr14 / 31702 | FlyBaseID: | FBgn0029974 | Length: | 340 | Species: | Drosophila melanogaster |
Alignment Length: | 205 | Identity: | 52/205 - (25%) |
---|---|---|---|
Similarity: | 80/205 - (39%) | Gaps: | 43/205 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 DVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGS 105
Fly 106 AIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPV-IAENTPKST---LVTEGQNLE 166
Fly 167 LTCHANGFPKPT--ISWAREHNAVMPAGGHLLAEPTLR-------------------IRSVHRMD 210
Fly 211 RGGYYCIAQN 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ama | NP_731114.2 | I-set | 33..143 | CDD:254352 | 27/101 (27%) |
Ig | 37..127 | CDD:299845 | 23/85 (27%) | ||
IG_like | 154..234 | CDD:214653 | 21/91 (23%) | ||
IGc2 | 161..223 | CDD:197706 | 20/81 (25%) | ||
I-set | 254..330 | CDD:254352 | |||
IGc2 | 254..322 | CDD:197706 | |||
dpr14 | NP_001245573.1 | IG_like | 83..163 | CDD:214653 | 25/89 (28%) |
Ig | 84..169 | CDD:299845 | 26/94 (28%) | ||
IG_like | 191..279 | CDD:214653 | 20/87 (23%) | ||
Ig | 201..274 | CDD:143165 | 19/77 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |