| Sequence 1: | NP_731114.2 | Gene: | Ama / 40831 | FlyBaseID: | FBgn0000071 | Length: | 341 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_981954.2 | Gene: | Ncam2 / 288280 | RGDID: | 1303131 | Length: | 837 | Species: | Rattus norvegicus |
| Alignment Length: | 296 | Identity: | 75/296 - (25%) |
|---|---|---|---|
| Similarity: | 113/296 - (38%) | Gaps: | 41/296 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 47 GDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFR 111
Fly 112 IQNIEVSDMGPYECQVLVSATEKVT-KKLSLQIKTPPVIAENTPKSTLVTE-GQNLELTCHANGF 174
Fly 175 PKPTISWAREHNAVMPAGGHLL--AEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFR 237
Fly 238 PQIAVQRPKIAQMVSHSAE------LECSVQGYPAPTVVWHK--NGVPLQSSRHHEVANTASSSG 294
Fly 295 TTTSVLRIDSVGEEDFGDYYCNATNKLGHADARLHL 330 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ama | NP_731114.2 | I-set | 33..143 | CDD:254352 | 22/96 (23%) |
| Ig | 37..127 | CDD:299845 | 20/79 (25%) | ||
| IG_like | 154..234 | CDD:214653 | 24/82 (29%) | ||
| IGc2 | 161..223 | CDD:197706 | 22/64 (34%) | ||
| I-set | 254..330 | CDD:254352 | 18/83 (22%) | ||
| IGc2 | 254..322 | CDD:197706 | 17/75 (23%) | ||
| Ncam2 | NP_981954.2 | IgI_1_NCAM-2 | 21..113 | CDD:409452 | |
| Ig strand B | 38..42 | CDD:409452 | |||
| Ig strand C | 50..54 | CDD:409452 | |||
| Ig strand E | 76..80 | CDD:409452 | |||
| Ig strand F | 90..95 | CDD:409452 | |||
| Ig strand G | 104..107 | CDD:409452 | |||
| IGc2 | 128..189 | CDD:197706 | 20/80 (25%) | ||
| Ig strand B | 130..139 | CDD:409353 | 2/8 (25%) | ||
| Ig strand C | 145..153 | CDD:409353 | 3/7 (43%) | ||
| Ig strand C' | 156..159 | CDD:409353 | 0/2 (0%) | ||
| Ig strand D | 162..167 | CDD:409353 | 2/4 (50%) | ||
| Ig strand E | 168..175 | CDD:409353 | 1/15 (7%) | ||
| IgI_1_MuSK | 209..298 | CDD:409562 | 26/95 (27%) | ||
| Ig strand B | 228..232 | CDD:409562 | 1/3 (33%) | ||
| Ig strand C | 241..245 | CDD:409562 | 2/3 (67%) | ||
| Ig strand E | 264..268 | CDD:409562 | 1/3 (33%) | ||
| Ig strand F | 278..283 | CDD:409562 | 2/4 (50%) | ||
| Ig strand G | 291..294 | CDD:409562 | 1/2 (50%) | ||
| Ig | 300..397 | CDD:416386 | 25/97 (26%) | ||
| Ig strand A | 300..305 | CDD:409353 | 3/5 (60%) | ||
| Ig strand A' | 309..313 | CDD:409353 | 0/3 (0%) | ||
| Ig strand B | 317..325 | CDD:409353 | 2/7 (29%) | ||
| Ig strand C | 331..337 | CDD:409353 | 1/5 (20%) | ||
| Ig strand C' | 340..343 | CDD:409353 | 2/2 (100%) | ||
| Ig strand D | 353..359 | CDD:409353 | 0/5 (0%) | ||
| Ig strand E | 362..368 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 376..384 | CDD:409353 | 4/7 (57%) | ||
| Ig strand G | 387..397 | CDD:409353 | 3/9 (33%) | ||
| Ig_3 | 401..479 | CDD:404760 | |||
| Ig strand B | 418..422 | CDD:409353 | |||
| Ig strand C | 431..435 | CDD:409353 | |||
| Ig strand E | 458..462 | CDD:409353 | |||
| Ig strand F | 472..477 | CDD:409353 | |||
| Ig strand G | 486..489 | CDD:409353 | |||
| FN3 | 496..588 | CDD:238020 | |||
| fn3 | 594..678 | CDD:394996 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.900 | |||||