DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and dpr9

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:285 Identity:70/285 - (24%)
Similarity:112/285 - (39%) Gaps:50/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AISLDSVLSA-PVISQ-ISKDVVASVGDSVEFNCTVEEVGQ----LSVSWAKRPSESDTNSVVLS 81
            :|.|:...:| |...: .||:|.|.:|.:...||.|:.:|.    |.|||.:   ..|.:  :|:
  Fly   245 SIDLEEARNAGPYFDKAFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVR---HRDIH--LLT 304

  Fly    82 MRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTP 146
            :.......|||:.  ....|:|..  :..:|:..:..|.|.||||  ||.|..::..:.|.:..|
  Fly   305 VGRYTYTSDQRFR--AIHQPQTED--WMLQIKYPQHRDSGIYECQ--VSTTPHMSHYIHLNVVEP 363

  Fly   147 PVIAENTPKSTLVTEGQNLELTCHANGFPKPT--ISWAREHNAVMPAGGHLLAEPTLRIRSVHRM 209
            .......| ...:..|..:.|||.....|:|.  |.|  .||...|:...::.         :..
  Fly   364 STEIIGAP-DLYIESGSTINLTCIIQNSPEPPAYIFW--NHNNAFPSHPQIIN---------YDS 416

  Fly   210 DRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWH-K 273
            .|||...:...|:......||:   ..||             |.|...:|:.......:|..| .
  Fly   417 PRGGVSVVTNKGDTTTSFLLIK---SARP-------------SDSGHYQCNPSNAKPKSVTVHVL 465

  Fly   274 NGVPLQSSRHHEVANTASSSGTTTS 298
            |||....||  .|.::.::.||:.|
  Fly   466 NGVSHSVSR--GVPSSNAARGTSAS 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 32/114 (28%)
Ig 37..127 CDD:299845 26/94 (28%)
IG_like 154..234 CDD:214653 18/81 (22%)
IGc2 161..223 CDD:197706 15/63 (24%)
I-set 254..330 CDD:254352 13/46 (28%)
IGc2 254..322 CDD:197706 13/46 (28%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 31/108 (29%)
IG_like 263..360 CDD:214653 31/107 (29%)
IG_like 371..464 CDD:214653 24/120 (20%)
IGc2 377..456 CDD:197706 22/105 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.