DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and dpr9

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_996215.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:285 Identity:70/285 - (24%)
Similarity:112/285 - (39%) Gaps:50/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AISLDSVLSA-PVISQ-ISKDVVASVGDSVEFNCTVEEVGQ----LSVSWAKRPSESDTNSVVLS 81
            :|.|:...:| |...: .||:|.|.:|.:...||.|:.:|.    |.|||.:   ..|.:  :|:
  Fly   245 SIDLEEARNAGPYFDKAFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVR---HRDIH--LLT 304

  Fly    82 MRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTP 146
            :.......|||:.  ....|:|..  :..:|:..:..|.|.||||  ||.|..::..:.|.:..|
  Fly   305 VGRYTYTSDQRFR--AIHQPQTED--WMLQIKYPQHRDSGIYECQ--VSTTPHMSHYIHLNVVEP 363

  Fly   147 PVIAENTPKSTLVTEGQNLELTCHANGFPKPT--ISWAREHNAVMPAGGHLLAEPTLRIRSVHRM 209
            .......| ...:..|..:.|||.....|:|.  |.|  .||...|:...::.         :..
  Fly   364 STEIIGAP-DLYIESGSTINLTCIIQNSPEPPAYIFW--NHNNAFPSHPQIIN---------YDS 416

  Fly   210 DRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWH-K 273
            .|||...:...|:......||:   ..||             |.|...:|:.......:|..| .
  Fly   417 PRGGVSVVTNKGDTTTSFLLIK---SARP-------------SDSGHYQCNPSNAKPKSVTVHVL 465

  Fly   274 NGVPLQSSRHHEVANTASSSGTTTS 298
            |||....||  .|.::.::.||:.|
  Fly   466 NGVSHSVSR--GVPSSNAARGTSAS 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 32/114 (28%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..68 CDD:409353 3/4 (75%)
Ig strand E 101..112 CDD:409353 2/10 (20%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig_3 146..220 CDD:464046 16/75 (21%)
I-set 254..330 CDD:400151 13/46 (28%)
Ig strand B 255..259 CDD:409353 0/3 (0%)
Ig strand C 268..272 CDD:409353 1/3 (33%)
Ig strand E 298..302 CDD:409353 1/1 (100%)
Ig strand F 312..317 CDD:409353
dpr9NP_996215.1 IG_like 263..360 CDD:214653 31/107 (29%)
Ig strand B 274..278 CDD:409355 0/3 (0%)
Ig strand C 291..295 CDD:409355 2/3 (67%)
Ig strand E 327..331 CDD:409355 0/3 (0%)
Ig strand F 341..346 CDD:409355 4/6 (67%)
IG_like 371..464 CDD:214653 24/120 (20%)
Ig strand B 381..385 CDD:143220 1/3 (33%)
Ig strand C 396..400 CDD:143220 2/5 (40%)
Ig strand E 431..437 CDD:143220 0/5 (0%)
Ig strand F 447..452 CDD:143220 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.