DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and MDGA1

DIOPT Version :10

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_006715119.1 Gene:MDGA1 / 266727 HGNCID:19267 Length:973 Species:Homo sapiens


Alignment Length:329 Identity:85/329 - (25%)
Similarity:135/329 - (41%) Gaps:67/329 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QISKDVV-----ASVGDSVEFNCTVEEVGQLSVS--WAKRPSESDTNSVVLSMRNILSLPDQRYN 94
            ||:.||:     ..:|..::.:|.|:.|.|..|:  |.|....:..:..:|..||...||     
Human   335 QITPDVIKESENIQLGQDLKLSCHVDAVPQEKVTYQWFKNGKPARMSKRLLVTRNDPELP----- 394

  Fly    95 VTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIK-----TPPVIAENTP 154
             .||.         :..:.::..||.|.|.|  :.|........||:::.     .||.|  :.|
Human   395 -AVTS---------SLELIDLHFSDYGTYLC--MAS
FPGAPVPDLSVEVNISSETVPPTI--SVP 445

  Fly   155 KS---TLVTEGQNLELTCHANGFPKPTISWAR--EHNAVMPAGGHLLAEP--TLRIRSVHRMDRG 212
            |.   ..|.||...||.|...|.|:|.:.|:|  :..|::|:|..|...|  .||:..|.|...|
Human   446 KGRAVVTVREGSPAELQCEVRGKPRPPVLWSRVDKEAALLPSGLPLEETPDGKLRLERVSRDMSG 510

  Fly   213 GYYCIAQNGEG---QPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECS-VQGYP--APTVVW 271
            .|.|......|   :|.:..:::.|:|.|::......:.|.:.....|.|| ::|.|  ..:.||
Human   511 TYRCQ
TARYNGFNVRPREAQVQLNVQFPPEVEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVW 575

  Fly   272 HKNG--------VPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHADARL 328
            ...|        ||            |::.....:.||:|:|..:..|.|.|:.:|.:|.|..  
Human   576 RFKGQLLPPPPVVP------------AAAEAPDHAELRLDAVTRDSSGSYECSVSNDVGSAAC-- 626

  Fly   329 HLFQ 332
             |||
Human   627 -LFQ 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:400151 27/112 (24%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..68 CDD:409353 2/6 (33%)
Ig strand E 101..112 CDD:409353 0/10 (0%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig_3 146..220 CDD:464046 28/80 (35%)
I-set 254..330 CDD:400151 21/86 (24%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 1/3 (33%)
Ig strand E 298..302 CDD:409353 1/3 (33%)
Ig strand F 312..317 CDD:409353 2/4 (50%)
MDGA1XP_006715119.1 Ig 44..115 CDD:472250
Ig strand B 56..60 CDD:409353
Ig strand C 69..73 CDD:409353
Ig strand E 91..95 CDD:409353
Ig strand F 105..110 CDD:409353
IG_like 152..217 CDD:214653
Ig strand B 153..157 CDD:409353
Ig strand C 166..170 CDD:409353
Ig strand E 197..201 CDD:409353
Ig strand F 211..216 CDD:409353
IG_like 248..326 CDD:214653
Ig strand B 258..262 CDD:409412
Ig strand C 272..276 CDD:409412
Ig strand E 291..295 CDD:409412
Ig strand F 305..310 CDD:409412
Ig 334..418 CDD:472250 24/99 (24%)
Ig strand B 353..357 CDD:409353 0/3 (0%)
Ig strand C 368..372 CDD:409353 0/3 (0%)
Ig strand E 398..402 CDD:409353 0/12 (0%)
Ig strand F 412..417 CDD:409353 2/6 (33%)
Ig_3 439..515 CDD:464046 27/77 (35%)
Ig_3 538..619 CDD:464046 20/92 (22%)
MAM 753..916 CDD:99706
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.