DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and NEGR1

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:285 Identity:87/285 - (30%)
Similarity:134/285 - (47%) Gaps:26/285 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFR 111
            ||:....|.:|: |....:|..|      :|::.:..:..|: |.|.:::.     .....|:.:
Human    53 GDTAVLRCYLED-GASKGAWLNR------SSIIFAGGDKWSV-DPRVSIST-----LNKRDYSLQ 104

  Fly   112 IQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPK 176
            |||::|:|.|||.|.|....|.: |.::.|.::.||.|.:.:...| |.||.|:.|||.|.|.|:
Human   105 IQNVDVTDDGPYTCSVQTQHTPR-TMQVHLTV
QVPPKIYDISNDMT-VNEGTNVTLTCLATGKPE 167

  Fly   177 PTISWAREHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIA 241
            |:|||..    :.|:.........|.|..:.|...|.|.|.|:|....||.|.::|.|.|.|  .
Human   168 PSISWRH----ISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAP--T 226

  Fly   242 VQRPKIAQMV-SHSAELECSVQGYPAPTVVWHKNGVPLQSSRHHEVANTASSSGTTTSVLRIDSV 305
            :|..|...:. ..|..:.|...|.|.|...|:|....|.:.:...:....|    |.|:|.:.:|
Human   227 IQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFS----TRSILTVTNV 287

  Fly   306 GEEDFGDYYCNATNKLGHADARLHL 330
            .:|.||:|.|.|.||||..:|.|.|
Human   288 TQEHFGNYTCVAANKLGTTNASLPL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352 25/95 (26%)
Ig 37..127 CDD:299845 21/79 (27%)
IG_like 154..234 CDD:214653 28/79 (35%)
IGc2 161..223 CDD:197706 22/61 (36%)
I-set 254..330 CDD:254352 25/75 (33%)
IGc2 254..322 CDD:197706 21/67 (31%)
NEGR1NP_776169.2 IG 47..135 CDD:214652 25/95 (26%)
IGc2 152..210 CDD:197706 22/61 (36%)
Ig_3 225..301 CDD:372822 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143430
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I4716
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42757
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.