DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ama and Lrit1

DIOPT Version :9

Sequence 1:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_647547.2 Gene:Lrit1 / 246214 RGDID:628607 Length:623 Species:Rattus norvegicus


Alignment Length:109 Identity:35/109 - (32%)
Similarity:54/109 - (49%) Gaps:15/109 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 EVEFR----PQIAVQRPKIAQMVS---HSAELECSVQGYPAPTVVWHK-NGVPLQSSRHHEVANT 289
            ::|.|    |::   ||.:..::|   .:..|.|...|.|.|.:.|.: ||.||..:.|.||   
  Rat   245 QLELRKCQSPEL---RPGVTSIISPLGSTVLLRCGATGIPGPEMSWRRANGRPLNGTVHQEV--- 303

  Fly   290 ASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHADARLHLFQT 333
             ||.|::.::|.:..|...|.|||.|.|.|.||.::..:.|..|
  Rat   304 -SSDGSSWTLLDLPVVSLFDSGDYICQAKNFLGASETLISLIVT 346

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
AmaNP_731114.2 I-set 33..143 CDD:254352
Ig 37..127 CDD:299845